RNAtranslator is a generative language model that redefines RNA design as a sequence-to-sequence translation problem, treating proteins and RNAs as "languages." By learning from millions of protein-RNA interactions, RNAtranslator directly generates novel RNA sequences with:
- High binding affinity
- Structural and functional similarity to natural RNAs
- No need for post-generation optimization
This innovation opens new frontiers in RNA therapeutics, especially for undruggable proteins, and unlocks powerful tools for synthetic biology. The RNAtranslator model uses an encoderβdecoder transformer architecture. During training, the encoder is provided with the target protein sequence while the decoder learns to regenerate the binding RNA sequence. At inference, the model takes a protein sequence as input and generates candidate RNA sequences by sampling from the learned distribution.
- Sequence-to-Sequence Translation: Reformulates RNA design as a natural language translation problem.
- Encoder-Decoder Transformer: Utilizes a transformer-based architecture for modeling proteinβRNA interactions.
- Large-Scale Training: Initially trained on 26 million RNAβprotein interactions (RNAInter dataset) and fine-tuned on 12 million experimentally validated interactions.
- Direct RNA Generation: Generates RNA sequences conditioned on a target protein sequence without additional optimization.
- Multi-GPU Support: Training is accelerated using Hugging Face Accelerate.
RNAtranslator is implemented in Python and uses PyTorch along with Hugging Face Accelerate for distributed training. We recommend using Conda to manage dependencies.
Create a dedicated Conda environment using the provided YAML file:
conda env create --name rnatranslator -f environment.yml
conda activate rnatranslatorrnatranslator/
βββ main.py # Main entry point to dispatch training, generation, or evaluation.
βββ train.py # Training procedure.
βββ generate.py # RNA generation procedure.
βββ evaluate.py # Evaluation procedure.
βββ environment.yml # Conda environment file.
βββ hyps/ # YAML files with training and model hyperparameters.
β βββ train.yaml
β βββ t5.yaml
βββ src/ # Source code for models, data handling, and utilities.
β βββ models/
β βββ data/
β βββ utils/
βββ examples/ # Example inputs and outputs.
βββ protein.fasta # Example protein FASTA file.
We provide a simple, Hugging Faceβbased interface to use our pretrained model to generate RNA sequences. Below, we show how we install, load, and run the model, along with small examples you can copyβpaste.
from transformers import T5ForConditionalGeneration, PreTrainedTokenizerFast
def postprocess_rna(rna):
return rna.replace('b', 'A').replace('j', 'C').replace(
'u', 'U').replace('z', 'G').replace(' ', '').replace(
'B', 'A').replace('J', 'C').replace('U', 'U').replace('Z', 'G')
# Load model
model = T5ForConditionalGeneration.from_pretrained("SobhanShukueian/rnatranslator")
# Load separate tokenizers
protein_tokenizer = PreTrainedTokenizerFast.from_pretrained("SobhanShukueian/rnatranslator", subfolder="protein_tokenizer")
rna_tokenizer = PreTrainedTokenizerFast.from_pretrained("SobhanShukueian/rnatranslator", subfolder="rna_tokenizer")
protein_seq = "MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT"
inputs = protein_tokenizer(protein_seq, return_tensors="pt").input_ids
# Generate RNA
gen_args = {
'max_length': 256,
'repetition_penalty': 1.5,
'encoder_repetition_penalty': 1.3,
'num_return_sequences': 1,
'top_k': 30,
'temperature': 1.5,
'num_beams': 1,
'do_sample': True,
}
outputs = model.generate(inputs, **gen_args)
rna_sequence = rna_tokenizer.decode(outputs[0], skip_special_tokens=True)
print(postprocess_rna(rna_sequence))RNAtranslator supports three main operational modes: training, generation, and evaluation. The main script (main.py) dispatches the appropriate procedure based on the selected run mode.
To train the model, use your preferred accelerator setup to launch the training procedure.
CUDA_VISIBLE_DEVICES=0,1 accelerate launch --config_file accelerate_config main.py --runmode train --train-hyp ./hyps/train.yaml --model-hyp ./hyps/model.yamlThe model uses hyperparameters defined in YAML files, and training logs, as well as checkpoints, are saved under the designated results directory.
RNAtranslator generates RNA sequences conditioned on a target protein. You can provide the input either as a protein FASTA file or directly as a protein name and sequence.
python main.py --runmode generate --protein-fasta ./examples/protein.fasta --rna_num 500 --max_len 75The generated sequences are stored in the designated inference directory. Adjust generation parameters such as the number of candidates, maximum sequence length, sampling strategy, and beam settings as needed.
To evaluate the generated RNA sequences and create analysis plots (e.g., binding affinity violin plots, box plots), run the evaluation mode.
python main.py --runmode evaluate --eval-dir ./results/validation --rnas_fasta rnas_fasta_dir
The evaluation outputs, including figures and metrics, are stored in the specified evaluation directory.
RNAtranslator has been designed for ease of use. After setting up your environment and configuring hyperparameters, you can run the training, generation, or evaluation modes directly through your preferred interface. Example usage scenarios include:
- Training: Launch the training process using your multi-GPU configuration.
./bashes/run_train.sh - Generation: Generate RNA sequences by providing a target protein (via FASTA file or direct input).
./bashes/run_generate.sh - Evaluation: Analyze and visualize the generated RNA sequences using the built-in evaluation scripts.
./bashes/run_evaluate.sh
Refer to the project documentation for further details on configuring run modes and parameter settings.
If you use RNAtranslator in your research, please consider citing our work:
- CC BY-NC-SA 2.0
- Β© [Year] RNAtranslator. For academic use only. For commercial applications, please contact the corresponding authors.
For questions or comments regarding RNAtranslator, please contact:
- Sobhan Shukueian Tabrizi: shukueian@gmail.com
Thank you for using RNAtranslator. We welcome your feedback and collaboration!
