diff --git a/go.mod b/go.mod index 99a8615..c6359ea 100644 --- a/go.mod +++ b/go.mod @@ -5,7 +5,7 @@ go 1.26.2 require ( github.com/go-openapi/errors v0.22.8 github.com/go-openapi/runtime v0.32.5 - github.com/go-openapi/strfmt v0.26.4 + github.com/go-openapi/strfmt v0.27.0 github.com/go-openapi/swag/conv v0.27.0 github.com/go-openapi/swag/jsonutils v0.27.0 github.com/go-openapi/swag/stringutils v0.27.0 @@ -40,8 +40,8 @@ require ( go.opentelemetry.io/otel/metric v1.44.0 // indirect go.opentelemetry.io/otel/trace v1.44.0 // indirect go.yaml.in/yaml/v3 v3.0.4 // indirect - golang.org/x/net v0.56.0 // indirect + golang.org/x/net v0.57.0 // indirect golang.org/x/sync v0.22.0 // indirect - golang.org/x/text v0.38.0 // indirect + golang.org/x/text v0.40.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) diff --git a/go.sum b/go.sum index dfa91e5..eec4cba 100644 --- a/go.sum +++ b/go.sum @@ -23,8 +23,8 @@ github.com/go-openapi/runtime/server-middleware v0.30.0 h1:8rPoJ/xv7JL8BsovaqboK github.com/go-openapi/runtime/server-middleware v0.30.0/go.mod h1:OYNT/TxNvB/VK5oe4htM2jDTwlEXuejVJmu0DVZfAMs= github.com/go-openapi/spec v0.22.6 h1:Tyy1pLaNCM8GBCFLoGYLonjJi6zykqyLCjXLc19ZPic= github.com/go-openapi/spec v0.22.6/go.mod h1:HZvTHat+iH0PALQRWhrqIHtU/PEqxqd89fu0MxGlMeM= -github.com/go-openapi/strfmt v0.26.4 h1:yI6IAEfcWow459BD5UzFY430KUwXZwBHrYusPFkhWlc= -github.com/go-openapi/strfmt v0.26.4/go.mod h1:hNJi6nb5ETD6i7A1yRo03M9S6ZoTPPoWff1iUexmfUc= +github.com/go-openapi/strfmt v0.27.0 h1:kbcTeaD9TXuXD0hhMXzuYa1sdTo6+dWGvwjW93E80IM= +github.com/go-openapi/strfmt v0.27.0/go.mod h1:s/qhDqfY72irigXUGJmtgid2Rm+3tnz3k8hZaRmvWYc= github.com/go-openapi/swag/conv v0.27.0 h1:EKOH4feXrvdo8DbSsXSAqRT8fz1epEnS5O2IfXUOzE8= github.com/go-openapi/swag/conv v0.27.0/go.mod h1:pfiv0uKQTbaGApk8Zs/lZV3uSjmSpa2FO1y183YngN8= github.com/go-openapi/swag/fileutils v0.27.0 h1:ib5jMUqGq5tY1EyO4inlrabsaeDAleFU+XD1FXQcgp8= @@ -84,14 +84,14 @@ go.opentelemetry.io/otel/trace v1.44.0 h1:jxF5CsGYCe74MCRx2X4g7WsY/VBKRqqpNvXlX/ go.opentelemetry.io/otel/trace v1.44.0/go.mod h1:oLl1jrMQAVo6v3GAggN+1VH9VIz9iUSvW53sW1Q8PIE= go.yaml.in/yaml/v3 v3.0.4 h1:tfq32ie2Jv2UxXFdLJdh3jXuOzWiL1fo0bu/FbuKpbc= go.yaml.in/yaml/v3 v3.0.4/go.mod h1:DhzuOOF2ATzADvBadXxruRBLzYTpT36CKvDb3+aBEFg= -golang.org/x/net v0.56.0 h1:Rw8j/hFzGvJUZwNBXnAtf5sVDVt+65SK2C7IxCxZt5o= -golang.org/x/net v0.56.0/go.mod h1:D3Ku6r+V6JROoZK144D2XfMHFcMq/0zSfLelVTCFKec= +golang.org/x/net v0.57.0 h1:K5+3DljvIuDG9/Jv9rvyMywYNFCQ9RSUY6OOTTkT+tE= +golang.org/x/net v0.57.0/go.mod h1:KpXc8iv+r3XplLAG/f7Jsf9RPszJzdR0f58q9vGOuEU= golang.org/x/sync v0.22.0 h1:SZjpbeLmrCk4xhRSZFNZW5gFUeCeFgjekvI/+gfScek= golang.org/x/sync v0.22.0/go.mod h1:9xrNwdLfx4jkKbNva9FpL6vEN7evnE43NNNJQ2LF3+0= -golang.org/x/sys v0.46.0 h1:noSf2Fq6F8DBgS+LysIkx7rIExoNHJsxOAtPp4rthXw= -golang.org/x/sys v0.46.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw= -golang.org/x/text v0.38.0 h1:sXmwo9DwP3OK9EZ7PqAdaooSGozfl/3a6/xJcbzPRhE= -golang.org/x/text v0.38.0/go.mod h1:YXZt3QhHUKYT53r2lLKFIVi6Ao1jdzrTR/KQ09qyxF4= +golang.org/x/sys v0.47.0 h1:o7XGOvZQCADBQQ4Y7VNq2dRWQR7JmOUW8Kxx4ZsNgWs= +golang.org/x/sys v0.47.0/go.mod h1:4GL1E5IUh+htKOUEOaiffhrAeqysfVGipDYzABqnCmw= +golang.org/x/text v0.40.0 h1:Ub2Z6/xjgF1WrYQz2nuITOEegKFtiIy+rieRJ5lHZKs= +golang.org/x/text v0.40.0/go.mod h1:hpnzDAfGV753zIKo+wk3u1bVKCGPbrnF7+7LBF/UHVY= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c h1:Hei/4ADfdWqJk1ZMxUNpqntNwaWcugrBjAiHlqqRiVk= gopkg.in/check.v1 v1.0.0-20201130134442-10cb98267c6c/go.mod h1:JHkPIbrfpd72SG/EVd6muEfDQjcINNoR0C8j2r3qZ4Q= diff --git a/vendor/github.com/go-openapi/strfmt/.gitignore b/vendor/github.com/go-openapi/strfmt/.gitignore index bbdffea..20c4e0f 100644 --- a/vendor/github.com/go-openapi/strfmt/.gitignore +++ b/vendor/github.com/go-openapi/strfmt/.gitignore @@ -4,3 +4,4 @@ .env .mcp.json go.work.sum +.worktrees diff --git a/vendor/github.com/go-openapi/strfmt/.golangci.yml b/vendor/github.com/go-openapi/strfmt/.golangci.yml index 8a3b3bf..31480c7 100644 --- a/vendor/github.com/go-openapi/strfmt/.golangci.yml +++ b/vendor/github.com/go-openapi/strfmt/.golangci.yml @@ -6,6 +6,8 @@ linters: - depguard - funlen - gomoddirectives + - gomodguard + - gomodguard_v2 - godox - exhaustruct - nlreturn diff --git a/vendor/github.com/go-openapi/strfmt/CONTRIBUTORS.md b/vendor/github.com/go-openapi/strfmt/CONTRIBUTORS.md index 4aa4fcb..fa17ff3 100644 --- a/vendor/github.com/go-openapi/strfmt/CONTRIBUTORS.md +++ b/vendor/github.com/go-openapi/strfmt/CONTRIBUTORS.md @@ -4,12 +4,12 @@ | Total Contributors | Total Contributions | | --- | --- | -| 40 | 239 | +| 41 | 243 | | Username | All Time Contribution Count | All Commits | | --- | --- | --- | | @casualjim | 88 | | -| @fredbi | 71 | | +| @fredbi | 74 | | | @youyuanwu | 13 | | | @jlambatl | 9 | | | @GlenDC | 5 | | @@ -26,6 +26,7 @@ | @bg451 | 2 | | | @aleksandr-vin | 2 | | | @ujjwalsh | 1 | | +| @patchwright | 1 | | | @kenjones-cisco | 1 | | | @jwalter1-quest | 1 | | | @ccoVeille | 1 | | diff --git a/vendor/github.com/go-openapi/strfmt/README.md b/vendor/github.com/go-openapi/strfmt/README.md index 4afef43..15ee0e5 100644 --- a/vendor/github.com/go-openapi/strfmt/README.md +++ b/vendor/github.com/go-openapi/strfmt/README.md @@ -67,7 +67,7 @@ It also provides convenient extensions to go-openapi users. - [x] go-openapi custom format extensions - bsonobjectid (BSON objectID) - creditcard - - duration (e.g. "3 weeks", "1ms") + - duration (e.g. "3 weeks", "1ms") (aka "duration-human") - hexcolor (e.g. "#FFFFFF") - isbn, isbn10, isbn13 - mac (e.g "01:02:03:04:05:06") @@ -76,11 +76,26 @@ It also provides convenient extensions to go-openapi users. - uuid, uuid3, uuid4, uuid5, uuid7 - cidr (e.g. "192.0.2.1/24", "2001:db8:a0b:12f0::1/32") - ulid (e.g. "00000PP9HGSBSSDZ1JTEXBJ0PW", [spec](https://github.com/ulid/spec)) +- [x] JSON-schema draft 2020 formats + - duration-iso8601 B(e.g. "P2W") > NOTE: as the name stands for, this package is intended to support string formatting only. > It does not provide validation for numerical values with swagger format extension for JSON types "number" or > "integer" (e.g. float, double, int32...). +## Durations + +We have 2 very different definitions of the "duration" format: the "human-readable" duration that used to be just "duration", +and the new "duration-iso8601". There is no "dual" parser that accepts both formats: types are specialized. + +To clarify the situation, a new alias for the duration format is introduced "duration-human" (e.g. "1 ms"), as opposed to +"duration-iso8601". + +The `Default` format registry wires "duration-human" as the default mapping for "duration" +(preexisting behavior, no breaking change - aligned with Swagger 2.0 which did not define "duration"). + +A new `JSONSchema2020` registry wires "duration-iso8601" as the default mapping for "duration". + ### Type conversion All types defined here are stringers and may be converted to strings with `.String()`. @@ -104,6 +119,7 @@ List of defined types: - Date - DateTime - Duration +- DurationISO8601 and `ISODuration[P ISODurationPolicy]` (for optional behavior) - Email - HexColor - Hostname diff --git a/vendor/github.com/go-openapi/strfmt/bson.go b/vendor/github.com/go-openapi/strfmt/bson.go index 16a83f6..b0c05d8 100644 --- a/vendor/github.com/go-openapi/strfmt/bson.go +++ b/vendor/github.com/go-openapi/strfmt/bson.go @@ -10,11 +10,6 @@ import ( "fmt" ) -func init() { //nolint:gochecknoinits // registers bsonobjectid format in the default registry - var id ObjectId - Default.Add("bsonobjectid", &id, IsBSONObjectID) -} - // IsBSONObjectID returns true when the string is a valid BSON [ObjectId]. func IsBSONObjectID(str string) bool { _, err := objectIDFromHex(str) diff --git a/vendor/github.com/go-openapi/strfmt/country.go b/vendor/github.com/go-openapi/strfmt/country.go new file mode 100644 index 0000000..39aeb3d --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/country.go @@ -0,0 +1,173 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +package strfmt + +import ( + "database/sql/driver" + "encoding/json" + "fmt" + + "github.com/go-openapi/strfmt/internal/countries" +) + +// Country represents an ISO 3166 country alpha-3 or alpha-2 code as a string format. +// +// swagger:strfmt country. +type Country struct { + countries.Country + + l int +} + +const ( + alpha2Len = 2 + alpha3Len = 3 +) + +// IsCountry checks if a string is a valid ISO 3166 country format. +func IsCountry(str string) bool { + _, err := ParseCountry(str) + + return err == nil +} + +// ParseCountry parses a string that represents a valid [Country]. +func ParseCountry(str string) (Country, error) { + l := len(str) + switch l { + case alpha3Len: + c, ok := countries.CountriesISO3[str] + if !ok { + return Country{}, fmt.Errorf("unrecognized strfmt.Country %q: %w", str, ErrFormat) + } + + return Country{Country: c, l: alpha3Len}, nil + case alpha2Len: + c, ok := countries.CountriesISO2[str] + if !ok { + return Country{}, fmt.Errorf("unrecognized strfmt.Country %q: %w", str, ErrFormat) + } + + return Country{Country: c, l: alpha2Len}, nil + default: + return Country{}, fmt.Errorf("invalid length for strfmt.Country in: %q: %w", str, ErrFormat) + } +} + +// MarshalText returns this instance into text. +func (u Country) MarshalText() ([]byte, error) { + return []byte(u.String()), nil +} + +// UnmarshalText hydrates this instance from text. +func (u *Country) UnmarshalText(data []byte) error { // validation is performed later on + c, err := ParseCountry(string(data)) + if err != nil { + return err + } + + *u = c + + return nil +} + +// Scan read a value from a database driver. +func (u *Country) Scan(raw any) error { + switch v := raw.(type) { + case []byte: + c, err := ParseCountry(string(v)) + if err != nil { + return err + } + *u = c + case string: + c, err := ParseCountry(v) + if err != nil { + return err + } + *u = c + default: + return fmt.Errorf("cannot sql.Scan() strfmt.Country from: %#v: %w", v, ErrFormat) + } + + return nil +} + +// Value converts a value to a database driver value. +func (u Country) Value() (driver.Value, error) { + return driver.Value(u.String()), nil +} + +func (u Country) String() string { + switch u.l { + case alpha3Len: + return u.ISOAlpha3 + case alpha2Len: + return u.ISOAlpha2 + default: + return "" + } +} + +// MarshalJSON returns the [Country] as JSON. +func (u Country) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +// UnmarshalJSON sets the [Country] from JSON. +func (u *Country) UnmarshalJSON(data []byte) error { + if string(data) == jsonNull { + return nil + } + var ustr string + if err := json.Unmarshal(data, &ustr); err != nil { + return err + } + + c, err := ParseCountry(ustr) + if err != nil { + return err + } + + *u = c + + return nil +} + +// DeepCopyInto copies the receiver and writes its value into out. +func (u *Country) DeepCopyInto(out *Country) { + *out = *u +} + +// DeepCopy copies the receiver into a new [Country]. +func (u *Country) DeepCopy() *Country { + if u == nil { + return nil + } + + out := new(Country) + u.DeepCopyInto(out) + + return out +} + +// GobEncode implements the gob.GobEncoder interface. +func (u Country) GobEncode() ([]byte, error) { + return u.MarshalText() +} + +// GobDecode implements the gob.GobDecoder interface. +func (u *Country) GobDecode(data []byte) error { + return u.UnmarshalText(data) +} + +// MarshalBinary implements the encoding.[encoding.BinaryMarshaler] interface. +func (u Country) MarshalBinary() ([]byte, error) { + return u.MarshalText() +} + +// UnmarshalBinary implements the encoding.[encoding.BinaryUnmarshaler] interface. +func (u *Country) UnmarshalBinary(data []byte) error { + return u.UnmarshalText(data) +} diff --git a/vendor/github.com/go-openapi/strfmt/currency.go b/vendor/github.com/go-openapi/strfmt/currency.go new file mode 100644 index 0000000..7af1156 --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/currency.go @@ -0,0 +1,146 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +package strfmt + +import ( + "database/sql/driver" + "encoding/json" + "fmt" + + "golang.org/x/text/currency" +) + +// Currency represents an ISO 4217 currency alpha-3 code as a string format. +// +// # Implementation +// +// golang.org/x/text/currency +// +// swagger:strfmt currency. +type Currency struct { + currency.Unit +} + +// IsCurrency checks if a string is a valid currency format. +func IsCurrency(str string) bool { + _, err := ParseCurrency(str) + + return err == nil +} + +// ParseCurrency parses a string that represents a valid [Currency]. +func ParseCurrency(str string) (Currency, error) { + cur, err := currency.ParseISO(str) + + return Currency{Unit: cur}, err +} + +// MarshalText returns this instance into text. +func (u Currency) MarshalText() ([]byte, error) { + return []byte(u.Unit.String()), nil +} + +// UnmarshalText hydrates this instance from text. +func (u *Currency) UnmarshalText(data []byte) error { // validation is performed later on + cur, err := ParseCurrency(string(data)) + if err != nil { + return err + } + *u = cur + + return nil +} + +// Scan read a value from a database driver. +func (u *Currency) Scan(raw any) error { + switch v := raw.(type) { + case []byte: + cur, err := ParseCurrency(string(v)) + if err != nil { + return err + } + *u = cur + case string: + cur, err := ParseCurrency(v) + if err != nil { + return err + } + *u = cur + default: + return fmt.Errorf("cannot sql.Scan() strfmt.Currency from: %#v: %w", v, ErrFormat) + } + + return nil +} + +// Value converts a value to a database driver value. +func (u Currency) Value() (driver.Value, error) { + return driver.Value(u.String()), nil +} + +func (u Currency) String() string { + return u.Unit.String() +} + +// MarshalJSON returns the [Currency] as JSON. +func (u Currency) MarshalJSON() ([]byte, error) { + return json.Marshal(u.String()) +} + +// UnmarshalJSON sets the [Currency] from JSON. +func (u *Currency) UnmarshalJSON(data []byte) error { + if string(data) == jsonNull { + return nil + } + var ustr string + if err := json.Unmarshal(data, &ustr); err != nil { + return err + } + + cur, err := ParseCurrency(ustr) + if err != nil { + return err + } + + *u = cur + + return nil +} + +// DeepCopyInto copies the receiver and writes its value into out. +func (u *Currency) DeepCopyInto(out *Currency) { + *out = *u +} + +// DeepCopy copies the receiver into a new [Currency]. +func (u *Currency) DeepCopy() *Currency { + if u == nil { + return nil + } + + out := new(Currency) + u.DeepCopyInto(out) + + return out +} + +// GobEncode implements the gob.GobEncoder interface. +func (u Currency) GobEncode() ([]byte, error) { + return u.MarshalText() +} + +// GobDecode implements the gob.GobDecoder interface. +func (u *Currency) GobDecode(data []byte) error { + return u.UnmarshalText(data) +} + +// MarshalBinary implements the encoding.[encoding.BinaryMarshaler] interface. +func (u Currency) MarshalBinary() ([]byte, error) { + return u.MarshalText() +} + +// UnmarshalBinary implements the encoding.[encoding.BinaryUnmarshaler] interface. +func (u *Currency) UnmarshalBinary(data []byte) error { + return u.UnmarshalText(data) +} diff --git a/vendor/github.com/go-openapi/strfmt/date.go b/vendor/github.com/go-openapi/strfmt/date.go index 59ee1f1..6d0e8a0 100644 --- a/vendor/github.com/go-openapi/strfmt/date.go +++ b/vendor/github.com/go-openapi/strfmt/date.go @@ -10,11 +10,6 @@ import ( "time" ) -func init() { //nolint:gochecknoinits // registers date format in the default registry - d := Date{} - Default.Add("date", &d, IsDate) -} - // IsDate returns true when the string is a valid date. func IsDate(str string) bool { _, err := time.Parse(RFC3339FullDate, str) diff --git a/vendor/github.com/go-openapi/strfmt/default.go b/vendor/github.com/go-openapi/strfmt/default.go index 725cc0e..bcc57e6 100644 --- a/vendor/github.com/go-openapi/strfmt/default.go +++ b/vendor/github.com/go-openapi/strfmt/default.go @@ -32,22 +32,22 @@ const ( ) const ( - // UUIDPattern Regex for [UUID] that allows uppercase + // UUIDPattern Regex for [UUID] that allows uppercase. // // Deprecated: [strfmt] no longer uses regular expressions to validate UUIDs. UUIDPattern = `(?i)(^[0-9a-f]{8}-[0-9a-f]{4}-[0-9a-f]{4}-[0-9a-f]{4}-[0-9a-f]{12}$)|(^[0-9a-f]{32}$)` - // UUID3Pattern Regex for [UUID3] that allows uppercase + // UUID3Pattern Regex for [UUID3] that allows uppercase. // // Deprecated: [strfmt] no longer uses regular expressions to validate UUIDs. UUID3Pattern = `(?i)(^[0-9a-f]{8}-[0-9a-f]{4}-3[0-9a-f]{3}-[0-9a-f]{4}-[0-9a-f]{12}$)|(^[0-9a-f]{12}3[0-9a-f]{3}?[0-9a-f]{16}$)` - // UUID4Pattern Regex for [UUID4] that allows uppercase + // UUID4Pattern Regex for [UUID4] that allows uppercase. // // Deprecated: [strfmt] no longer uses regular expressions to validate UUIDs. UUID4Pattern = `(?i)(^[0-9a-f]{8}-[0-9a-f]{4}-4[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$)|(^[0-9a-f]{12}4[0-9a-f]{3}[89ab][0-9a-f]{15}$)` - // UUID5Pattern Regex for [UUID]5 that allows uppercase + // UUID5Pattern Regex for [UUID]5 that allows uppercase. // // Deprecated: [strfmt] no longer uses regular expressions to validate UUIDs. UUID5Pattern = `(?i)(^[0-9a-f]{8}-[0-9a-f]{4}-5[0-9a-f]{3}-[89ab][0-9a-f]{3}-[0-9a-f]{12}$)|(^[0-9a-f]{12}5[0-9a-f]{3}[89ab][0-9a-f]{15}$)` @@ -88,8 +88,8 @@ var ( // IsHostname returns true when the string is a valid hostname. // -// It follows the rules detailed at https://url.spec.whatwg.org/#concept-host-parser -// and implemented by most modern web browsers. +// It follows the rules detailed at https://url.spec.whatwg.org/#concept-host-parser and implemented by most modern web +// browsers. // // It supports IDNA rules regarding internationalized names with unicode. // @@ -142,13 +142,13 @@ func IsHostname(str string) bool { return true } -// domainEndsAsNumber determines if a domain name ends with a decimal, octal or hex digit, -// accounting for a possible trailing dot (the last part being empty in that case). +// domainEndsAsNumber determines if a domain name ends with a decimal, octal or hex digit, accounting for a possible +// trailing dot (the last part being empty in that case). // // It returns the last non-trailing dot part and if that part consists only of (dec/hex/oct) digits. func domainEndsAsNumber(parts []string) (lastPart string, lastIndex int, ok bool) { - // NOTE: using ParseUint(x, 0, 32) is not an option, as the IPv4 format supported why WHATWG - // doesn't support notations such as "0b1001" (binary digits) or "0o666" (alternate notation for octal digits). + // NOTE: using ParseUint(x, 0, 32) is not an option, as the IPv4 format supported why WHATWG doesn't support notations + // such as "0b1001" (binary digits) or "0o666" (alternate notation for octal digits). lastIndex = len(parts) - 1 lastPart = parts[lastIndex] if len(lastPart) == 0 { @@ -233,8 +233,9 @@ func isValidIPv6(str string) bool { // "0o07.2.3.4" func isValidIPv4(parts []string) bool { // NOTE: using ParseUint(x, 0, 32) is not an option, even though it would simplify this code a lot. - // The IPv4 format supported why WHATWG doesn't support notations such as "0b1001" (binary digits) - // or "0o666" (alternate notation for octal digits). + // + // The IPv4 format supported why WHATWG doesn't support notations such as "0b1001" (binary digits) or "0o666" + // (alternate notation for octal digits). const ( maxPartsInIPv4 = 4 maxDigitsInPart = 11 // max size of a 4-bytes hex or octal digit @@ -376,101 +377,22 @@ func IsEmail(str string) bool { return e == nil && addr.Address != "" } -func init() { //nolint:gochecknoinits // registers all default string formats in the registry - // register formats in the default registry: - // - byte - // - creditcard - // - email - // - hexcolor - // - hostname - // - ipv4 - // - ipv6 - // - cidr - // - isbn - // - isbn10 - // - isbn13 - // - mac - // - password - // - rgbcolor - // - ssn - // - uri - // - uuid - // - uuid3 - // - uuid4 - // - uuid5 - // - uuid7 - u := URI("") - Default.Add("uri", &u, isRequestURI) - - eml := Email("") - Default.Add("email", &eml, IsEmail) - - hn := Hostname("") - Default.Add("hostname", &hn, IsHostname) - - ip4 := IPv4("") - Default.Add("ipv4", &ip4, isIPv4) - - ip6 := IPv6("") - Default.Add("ipv6", &ip6, isIPv6) - - cidr := CIDR("") - Default.Add("cidr", &cidr, isCIDR) - - mac := MAC("") - Default.Add("mac", &mac, isMAC) - - uid := UUID("") - Default.Add("uuid", &uid, IsUUID) - - uid3 := UUID3("") - Default.Add("uuid3", &uid3, IsUUID3) - - uid4 := UUID4("") - Default.Add("uuid4", &uid4, IsUUID4) - - uid5 := UUID5("") - Default.Add("uuid5", &uid5, IsUUID5) - - uid7 := UUID7("") - Default.Add("uuid7", &uid7, IsUUID7) - - isbn := ISBN("") - Default.Add("isbn", &isbn, func(str string) bool { return isISBN10(str) || isISBN13(str) }) - - isbn10 := ISBN10("") - Default.Add("isbn10", &isbn10, isISBN10) - - isbn13 := ISBN13("") - Default.Add("isbn13", &isbn13, isISBN13) - - cc := CreditCard("") - Default.Add("creditcard", &cc, isCreditCard) - - ssn := SSN("") - Default.Add("ssn", &ssn, isSSN) - - hc := HexColor("") - Default.Add("hexcolor", &hc, isHexcolor) - - rc := RGBColor("") - Default.Add("rgbcolor", &rc, isRGBcolor) - - b64 := Base64([]byte(nil)) - Default.Add("byte", &b64, isBase64) - - pw := Password("") - Default.Add("password", &pw, func(_ string) bool { return true }) -} +// base64Encoding is the canonical alphabet for the [Base64] format. +// +// OpenAPI `format: byte` means standard base64 (RFC 4648 §4, the `+/` alphabet), not base64url. +// This is the single seam every [Base64] path encodes and decodes through, so a future URL-safe variant only swaps the +// encoding here. +// See go-openapi/strfmt#87. +var base64Encoding = base64.StdEncoding //nolint:gochecknoglobals // canonical alphabet seam for the Base64 format -// Base64 represents a base64 encoded string, using URLEncoding alphabet. +// Base64 represents a base64 encoded string, using the standard RFC 4648 alphabet. // // swagger:strfmt byte. type Base64 []byte // MarshalText turns this instance into text. func (b Base64) MarshalText() ([]byte, error) { - enc := base64.URLEncoding + enc := base64Encoding src := []byte(b) buf := make([]byte, enc.EncodedLen(len(src))) enc.Encode(buf, src) @@ -479,7 +401,7 @@ func (b Base64) MarshalText() ([]byte, error) { // UnmarshalText hydrates this instance from text. func (b *Base64) UnmarshalText(data []byte) error { // validation is performed later on - enc := base64.URLEncoding + enc := base64Encoding dbuf := make([]byte, enc.DecodedLen(len(data))) n, err := enc.Decode(dbuf, data) @@ -495,14 +417,14 @@ func (b *Base64) UnmarshalText(data []byte) error { // validation is performed l func (b *Base64) Scan(raw any) error { switch v := raw.(type) { case []byte: - dbuf := make([]byte, base64.StdEncoding.DecodedLen(len(v))) - n, err := base64.StdEncoding.Decode(dbuf, v) + dbuf := make([]byte, base64Encoding.DecodedLen(len(v))) + n, err := base64Encoding.Decode(dbuf, v) if err != nil { return err } *b = dbuf[:n] case string: - vv, err := base64.StdEncoding.DecodeString(v) + vv, err := base64Encoding.DecodeString(v) if err != nil { return err } @@ -520,7 +442,7 @@ func (b Base64) Value() (driver.Value, error) { } func (b Base64) String() string { - return base64.StdEncoding.EncodeToString([]byte(b)) + return base64Encoding.EncodeToString([]byte(b)) } // MarshalJSON returns the Base64 as JSON. @@ -534,7 +456,7 @@ func (b *Base64) UnmarshalJSON(data []byte) error { if err := json.Unmarshal(data, &b64str); err != nil { return err } - vb, err := base64.StdEncoding.DecodeString(b64str) + vb, err := base64Encoding.DecodeString(b64str) if err != nil { return err } @@ -1040,7 +962,7 @@ func (u *MAC) DeepCopy() *MAC { return out } -// UUID represents a [uuid] string format +// UUID represents a [uuid] string format. // // swagger:strfmt uuid. type UUID string @@ -1905,6 +1827,7 @@ func (r *RGBColor) DeepCopy() *RGBColor { } // Password represents a password. +// // This has no validations and is mainly used as a marker for UI components. // // swagger:strfmt password. @@ -1978,11 +1901,10 @@ func (r *Password) DeepCopy() *Password { } func isRequestURI(rawurl string) bool { - // url.ParseRequestURI assumes the input contains no "#fragment" - // (RFC 3986 §3.5). A URI with a fragment and an empty path, such as - // "https://host#@frag", is therefore misread as userinfo and rejected - // as "invalid userinfo". Strip the fragment first so the absolute - // request URI validates, matching url.Parse's RFC 3986 handling. + // url.ParseRequestURI assumes the input contains no "#fragment" (RFC 3986 §3.5). + // A URI with a fragment and an empty path, such as "https://host#@frag", is therefore misread as userinfo and rejected + // as "invalid userinfo". + // Strip the fragment first so the absolute request URI validates, matching url.Parse's RFC 3986 handling. if i := strings.IndexByte(rawurl, '#'); i >= 0 { rawurl = rawurl[:i] } @@ -2009,19 +1931,20 @@ func isCIDR(str string) bool { } // isMAC checks if a string is valid MAC address. +// // Possible MAC formats: -// 01:23:45:67:89:ab -// 01:23:45:67:89:ab:cd:ef -// 01-23-45-67-89-ab -// 01-23-45-67-89-ab-cd-ef -// 0123.4567.89ab -// 0123.4567.89ab.cdef. +// - 01:23:45:67:89:ab +// - 01:23:45:67:89:ab:cd:ef +// - 01-23-45-67-89-ab +// - 01-23-45-67-89-ab-cd-ef +// - 0123.4567.89ab 0123.4567.89ab.cdef func isMAC(str string) bool { _, err := net.ParseMAC(str) return err == nil } // isISBN checks if the string is an ISBN (version 10 or 13). +// // If version value is not equal to 10 or 13, it will be checks both variants. func isISBN(str string, version int) bool { sanitized := whiteSpacesAndMinus.ReplaceAllString(str, "") @@ -2120,7 +2043,7 @@ func isRGBcolor(str string) bool { // isBase64 checks if a string is base64 encoded. func isBase64(str string) bool { - _, err := base64.StdEncoding.DecodeString(str) + _, err := base64Encoding.DecodeString(str) return err == nil } diff --git a/vendor/github.com/go-openapi/strfmt/duration.go b/vendor/github.com/go-openapi/strfmt/duration.go index f2ab7ff..fc4de0d 100644 --- a/vendor/github.com/go-openapi/strfmt/duration.go +++ b/vendor/github.com/go-openapi/strfmt/duration.go @@ -12,11 +12,6 @@ import ( "unicode" ) -func init() { //nolint:gochecknoinits // registers duration format in the default registry - d := Duration(0) - Default.Add("duration", &d, IsDuration) -} - const ( hoursInDay = 24 daysInWeek = 7 @@ -174,6 +169,9 @@ func ParseDuration(s string) (time.Duration, error) { scale float64 = 1 // value = v + f/scale ) s = strings.TrimLeftFunc(s, unicode.IsSpace) + if s == "" { + break + } // The next character must be 0-9.] if s[0] != '.' && ('0' > s[0] || s[0] > '9') { diff --git a/vendor/github.com/go-openapi/strfmt/duration_iso8601.go b/vendor/github.com/go-openapi/strfmt/duration_iso8601.go new file mode 100644 index 0000000..9fded03 --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/duration_iso8601.go @@ -0,0 +1,583 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +package strfmt + +import ( + "database/sql/driver" + "encoding/json" + "fmt" + "math" + "strconv" + "strings" + "time" +) + +// ISO 8601 duration unit lengths, expressed in nanoseconds. +// +// Calendar units are collapsed to fixed lengths (a year is 365 days, a month is 30 days): a [time.Duration] cannot +// carry calendar context, so this conversion is inherently lossy and not calendar-correct. +// It matches the historical behaviour of ISO duration libraries in this space. +const ( + isoSecond = uint64(time.Second) + isoMinute = uint64(time.Minute) + isoHour = uint64(time.Hour) + isoDay = 24 * isoHour + isoWeek = 7 * isoDay + isoMonth = 30 * isoDay + isoYear = 365 * isoDay + + // maxDurationMagnitude is 1<<63: the magnitude of [math.MinInt64], and one more than [math.MaxInt64]. + // + // A parsed magnitude may reach exactly this value only for a negative duration (yielding [math.MinInt64]). + maxDurationMagnitude = uint64(1) << 63 +) + +// Base-10 parsing / formatting constants (decimalBase lives in default.go). +const ( + // decimalAccMax bounds a uint64 accumulator so that acc*decimalBase + 9 cannot overflow. + decimalAccMax = (math.MaxUint64 - (decimalBase - 1)) / decimalBase + // nanoDigits is the number of fractional digits in one whole second (nanosecond precision). + nanoDigits = 9 +) + +// ISODuration is an ISO 8601 / RFC 3339 duration (e.g. "P1Y2M3DT4H5M6S", "P2W"). +// +// The type parameter P selects the parsing policy at compile time (see [ISODurationPolicy]). +// Every instantiation is a distinct type that round-trips through JSON, text, SQL and BSON. +// Use the [DurationISO8601] alias for the strict, spec-compliant default. +// +// Like [time.Duration], it stores a nanosecond count; the largest representable duration is approximately 290 years. +// Calendar units are collapsed to fixed lengths (year = 365 days, month = 30 days), which is lossy by nature. +// +// This generic type carries no swagger:strfmt annotation: go-swagger binds a concrete format name to the +// [DurationISO8601] alias, not to a generic declaration. +type ISODuration[P ISODurationPolicy] time.Duration + +// DurationISO8601 is the strict, spec-compliant ISO 8601 duration: the JSON Schema draft 2020 "duration" format +// (RFC 3339 Appendix A). +// +// It binds to the explicit, unambiguous "duration-iso8601" handle. Plain "duration" is a context-dependent +// default resolved by the registry ([Default] → human, [JSONSchema2020Registry] → ISO), not by this static type. +// +// swagger:strfmt duration-iso8601. +type DurationISO8601 = ISODuration[DurationStrict] + +// ParseISO8601Duration parses an ISO 8601 / RFC 3339 duration string. +// +// With no options it enforces the strict RFC 3339 Appendix A grammar. +// Options relax individual rules for programmatic callers. +func ParseISO8601Duration(s string, opts ...ISODurationOption) (time.Duration, error) { + cfg := DurationStrict{}.isoDurationConfig() + for _, o := range opts { + o(&cfg) + } + return parseISO8601Duration(s, cfg) +} + +// --- Format / encoding methods --- + +// String renders the duration in canonical ISO 8601 form. +// +// Unlike [ISODuration.MarshalText], String is a best-effort display form: it always renders the true value (lossless), +// even under a strict policy that could not serialize it (e.g. a sign or sub-second precision). +func (d ISODuration[P]) String() string { return isoFormat(time.Duration(d)) } + +// MarshalText implements [encoding.TextMarshaler], applying the policy P: a strict policy errors on a value it cannot +// represent (see [isoEmit]). +func (d ISODuration[P]) MarshalText() ([]byte, error) { + var p P + s, err := isoEmit(time.Duration(d), p.isoDurationConfig()) + if err != nil { + return nil, err + } + return []byte(s), nil +} + +// UnmarshalText implements [encoding.TextUnmarshaler], applying the policy P. +func (d *ISODuration[P]) UnmarshalText(text []byte) error { + var p P + dd, err := parseISO8601Duration(string(text), p.isoDurationConfig()) + if err != nil { + return err + } + *d = ISODuration[P](dd) + return nil +} + +// MarshalJSON returns the duration as a JSON string, applying the policy P. +func (d ISODuration[P]) MarshalJSON() ([]byte, error) { + var p P + s, err := isoEmit(time.Duration(d), p.isoDurationConfig()) + if err != nil { + return nil, err + } + return json.Marshal(s) +} + +// UnmarshalJSON sets the duration from a JSON string, applying the policy P. +func (d *ISODuration[P]) UnmarshalJSON(data []byte) error { + if string(data) == jsonNull { + return nil + } + var str string + if err := json.Unmarshal(data, &str); err != nil { + return err + } + var p P + dd, err := parseISO8601Duration(str, p.isoDurationConfig()) + if err != nil { + return err + } + *d = ISODuration[P](dd) + return nil +} + +// Scan reads a duration (nanoseconds) from a database driver value. +func (d *ISODuration[P]) Scan(raw any) error { + switch v := raw.(type) { + case int64: + *d = ISODuration[P](v) + case float64: + *d = ISODuration[P](int64(v)) + case nil: + *d = ISODuration[P](0) + default: + return fmt.Errorf("cannot sql.Scan() strfmt.ISODuration from: %#v: %w", v, ErrFormat) + } + return nil +} + +// Value writes the duration as a nanosecond count. +func (d ISODuration[P]) Value() (driver.Value, error) { + return driver.Value(int64(d)), nil +} + +// Equal reports whether two durations are equal. +func (d ISODuration[P]) Equal(other ISODuration[P]) bool { return d == other } + +// DeepCopyInto copies the receiver into out. +func (d *ISODuration[P]) DeepCopyInto(out *ISODuration[P]) { *out = *d } + +// DeepCopy copies the receiver into a new value. +func (d *ISODuration[P]) DeepCopy() *ISODuration[P] { + if d == nil { + return nil + } + out := new(ISODuration[P]) + d.DeepCopyInto(out) + return out +} + +// IsDurationISO8601 returns true if the string is a valid strict ISO 8601 duration. +func IsDurationISO8601(s string) bool { + _, err := parseISO8601Duration(s, DurationStrict{}.isoDurationConfig()) + return err == nil +} + +func isoDurationError(input, msg string) error { + return fmt.Errorf("invalid ISO 8601 duration %q: %s: %w", input, msg, ErrFormat) +} + +// section positions used to enforce component ordering (strictly increasing). +// +//nolint:gochecknoglobals,mnd // immutable ordinal lookup tables; the integers are sequence positions, not magic constants +var ( + isoDatePos = map[byte]int{'Y': 1, 'M': 2, 'W': 3, 'D': 4} + isoTimePos = map[byte]int{'H': 1, 'M': 2, 'S': 3} +) + +// isoDateSlot maps the year/month/day designators to contiguous slots for the strict anchoring (gap) check. +// +// 'W' is deliberately excluded: in strict mode it is exclusive, so it never coexists with Y/M/D. +func isoDateSlot(des byte) (int, bool) { + switch des { + case 'Y': + return 0, true + case 'M': + return 1, true + case 'D': + return 2, true //nolint:mnd // contiguous slot index (Y=0, M=1, D=2), not a magic constant + default: + return 0, false + } +} + +//nolint:gocognit,gocyclo,cyclop // a single-pass grammar scanner; the branches mirror the ABNF. +func parseISO8601Duration(input string, cfg isoDurationConfig) (time.Duration, error) { + s := input + if cfg.allowSpace { + s = strings.TrimSpace(s) + } + + neg := false + if cfg.allowSign && s != "" && (s[0] == '+' || s[0] == '-') { + neg = s[0] == '-' + s = s[1:] + } + + if s == "" || s[0] != 'P' { + return 0, isoDurationError(input, `must start with "P"`) + } + s = s[1:] + if s == "" { + return 0, isoDurationError(input, "no components after P") + } + + var ( + total uint64 + inTime bool + seenAny bool + weekSeen bool + fractionUsed bool + lastDatePos int + lastTimePos int + datePresent [3]bool // Y, M, D — for the anchoring (gap) check + timePresent [3]bool // H, M, S + ) + + for s != "" { + c := s[0] + + if c == 'T' { + if inTime { + return 0, isoDurationError(input, `duplicate "T" separator`) + } + if weekSeen && !cfg.weekCombinable { + return 0, isoDurationError(input, `"W" cannot be combined with other components`) + } + inTime = true + s = s[1:] + if s == "" { + return 0, isoDurationError(input, `no components after "T"`) + } + continue + } + + // A fraction, if any, must be on the least significant component: nothing may follow it. + if fractionUsed { + return 0, isoDurationError(input, "a fraction is only allowed on the least significant component") + } + + // Scan the integer part (ASCII digits only). + i := 0 + for i < len(s) && s[i] >= '0' && s[i] <= '9' { + i++ + } + if i == 0 { + return 0, isoDurationError(input, fmt.Sprintf("expected a digit, got %q", s[0])) + } + intPart := s[:i] + + // Optional decimal fraction. + var fracPart string + hasFrac := false + if i < len(s) && (s[i] == '.' || s[i] == ',') { + if !cfg.allowFraction { + return 0, isoDurationError(input, "decimal fraction is not allowed") + } + hasFrac = true + j := i + 1 + for j < len(s) && s[j] >= '0' && s[j] <= '9' { + j++ + } + fracPart = s[i+1 : j] + i = j + } + + if i >= len(s) { + return 0, isoDurationError(input, "value without a unit designator") + } + des := s[i] + s = s[i+1:] + + unit, err := isoResolveUnit(input, des, inTime, cfg, + &lastDatePos, &lastTimePos, &weekSeen, seenAny, &datePresent, &timePresent) + if err != nil { + return 0, err + } + seenAny = true + if hasFrac { + fractionUsed = true + } + + val, err := isoScaleValue(input, intPart, fracPart, unit) + if err != nil { + return 0, err + } + + // Accumulate with the stdlib overflow discipline: the magnitude may reach 1<<63 only for a negative duration. + if total > maxDurationMagnitude-val { + return 0, isoDurationError(input, "value out of range") + } + total += val + } + + if inTime && !timePresent[0] && !timePresent[1] && !timePresent[2] { + return 0, isoDurationError(input, `no components after "T"`) + } + if !seenAny { + return 0, isoDurationError(input, "no components") + } + + // Strict anchoring: the present Y/M/D and H/M/S components must each form a contiguous run (e.g. P1Y2D and PT1H2S are + // rejected). + if !cfg.relaxAnchoring { + if err := isoCheckContiguous(input, datePresent, "date"); err != nil { + return 0, err + } + if err := isoCheckContiguous(input, timePresent, "time"); err != nil { + return 0, err + } + } + + if total > maxDurationMagnitude-1 { + if neg && total == maxDurationMagnitude { + return math.MinInt64, nil + } + return 0, isoDurationError(input, "value out of range") + } + if neg { + return -time.Duration(total), nil + } + return time.Duration(total), nil +} + +// isoResolveUnit validates a designator in context (section, ordering, week +// exclusivity) and returns its unit length in nanoseconds. +func isoResolveUnit( + input string, des byte, inTime bool, cfg isoDurationConfig, + lastDatePos, lastTimePos *int, weekSeen *bool, seenAny bool, + datePresent, timePresent *[3]bool, +) (uint64, error) { + if inTime { + pos, ok := isoTimePos[des] + if !ok { + return 0, isoDurationError(input, fmt.Sprintf("%q is not a valid time-section designator", des)) + } + if pos <= *lastTimePos { + return 0, isoDurationError(input, fmt.Sprintf("designator %q is out of order", des)) + } + *lastTimePos = pos + timePresent[pos-1] = true + switch des { + case 'H': + return isoHour, nil + case 'M': + return isoMinute, nil + default: // 'S' + return isoSecond, nil + } + } + + pos, ok := isoDatePos[des] + if !ok { + return 0, isoDurationError(input, fmt.Sprintf("%q is not a valid date-section designator", des)) + } + if pos <= *lastDatePos { + return 0, isoDurationError(input, fmt.Sprintf("designator %q is out of order", des)) + } + + if des == 'W' { + if !cfg.weekCombinable && seenAny { + return 0, isoDurationError(input, `"W" cannot be combined with other components`) + } + *lastDatePos = pos + *weekSeen = true + return isoWeek, nil + } + + if *weekSeen && !cfg.weekCombinable { + return 0, isoDurationError(input, `"W" cannot be combined with other components`) + } + *lastDatePos = pos + if slot, ok := isoDateSlot(des); ok { + datePresent[slot] = true + } + switch des { + case 'Y': + return isoYear, nil + case 'M': + return isoMonth, nil + default: // 'D' + return isoDay, nil + } +} + +// isoCheckContiguous rejects gaps in a section's component chain. +func isoCheckContiguous(input string, present [3]bool, section string) error { + first, last := -1, -1 + for i, p := range present { + if p { + if first < 0 { + first = i + } + last = i + } + } + if first < 0 { + return nil + } + for i := first; i <= last; i++ { + if !present[i] { + return isoDurationError(input, "non-contiguous "+section+" components (a gap in the unit chain)") + } + } + return nil +} + +// isoScaleValue converts an integer (and optional fractional) component to nanoseconds, checking every overflow +// boundary. +func isoScaleValue(input, intPart, fracPart string, unit uint64) (uint64, error) { + v, ok := isoParseUint(intPart) + if !ok { + return 0, isoDurationError(input, "value out of range") + } + // Bound v*unit to the duration magnitude *before* multiplying, so the later fractional addition cannot wrap a uint64. + if v > maxDurationMagnitude/unit { + return 0, isoDurationError(input, "value out of range") + } + val := v * unit + + if fracPart != "" { + f, scale := isoParseFraction(fracPart) + if f > 0 { + // float64 is accurate enough for a sub-unit fraction (matches the standard library technique); the magnitude stays + // below the uint64 ceiling because val <= 1<<63 and the addend is < unit. + val += uint64(float64(f) * (float64(unit) / float64(scale))) + if val > maxDurationMagnitude { + return 0, isoDurationError(input, "value out of range") + } + } + } + + return val, nil +} + +// isoParseUint parses digits into a uint64, reporting overflow. +func isoParseUint(s string) (uint64, bool) { + var v uint64 + for i := range len(s) { + if v > decimalAccMax { + return 0, false + } + v = v*decimalBase + uint64(s[i]-'0') + } + + return v, true +} + +// isoParseFraction parses fractional digits into (value, scale=10^len), capping precision at 18 digits so the value +// stays exact in the subsequent float maths. +func isoParseFraction(s string) (uint64, uint64) { + const maxFracDigits = 18 + if len(s) > maxFracDigits { + s = s[:maxFracDigits] + } + var f, scale uint64 = 0, 1 + for i := range len(s) { + f = f*decimalBase + uint64(s[i]-'0') + scale *= decimalBase + } + + return f, scale +} + +// isoFormat renders a duration in canonical ISO 8601 form (P[n]DT[n]H[n]M[n]S). +// +// Intermediate zero time components are emitted when needed to keep the output contiguous (e.g. 1h5s → "PT1H0M5S"), +// so the structure is always syntactically valid ISO 8601. Years, months and weeks are not reconstructed (a +// [time.Duration] does not carry calendar context); a fractional second is emitted losslessly, and a negative duration +// is prefixed with "-". +func isoFormat(d time.Duration) string { + if d == 0 { + return "PT0S" + } + neg := d < 0 + var u uint64 + if neg { + u = uint64(-d) + } else { + u = uint64(d) + } + + days := u / isoDay + u %= isoDay + hours := u / isoHour + u %= isoHour + minutes := u / isoMinute + u %= isoMinute + seconds := u / isoSecond + frac := u % isoSecond + + var b strings.Builder + if neg { + b.WriteByte('-') + } + + b.WriteByte('P') + if days > 0 { + b.WriteString(strconv.FormatUint(days, decimalBase)) + b.WriteByte('D') + } + isoWriteTimeSection(&b, hours, minutes, seconds, frac) + + return b.String() +} + +// isoWriteTimeSection appends the "T…" part of a canonical ISO 8601 duration, emitting a zero-minute filler when it +// must bridge hours and seconds so the output stays contiguous (e.g. 1h5s → "T1H0M5S"). +func isoWriteTimeSection(b *strings.Builder, hours, minutes, seconds, frac uint64) { + hasH := hours > 0 + hasM := minutes > 0 + hasS := seconds > 0 || frac > 0 + if !hasH && !hasM && !hasS { + return + } + + b.WriteByte('T') + if hasH { + b.WriteString(strconv.FormatUint(hours, decimalBase)) + b.WriteByte('H') + } + + // Emit minutes if non-zero, or as a zero filler bridging hours and seconds. + if hasM || (hasH && hasS) { + b.WriteString(strconv.FormatUint(minutes, decimalBase)) + b.WriteByte('M') + } + + if hasS { + b.WriteString(strconv.FormatUint(seconds, decimalBase)) + if frac > 0 { + b.WriteByte('.') + b.WriteString(isoFormatFraction(frac)) + } + b.WriteByte('S') + } +} + +// isoEmit renders d under the given policy. +// +// A policy that forbids a feature the value requires (a sign, or sub-second precision) cannot represent it, and returns +// an error rather than emitting output a matching parser would reject. +func isoEmit(d time.Duration, cfg isoDurationConfig) (string, error) { + if !cfg.allowSign && d < 0 { + return "", fmt.Errorf("a negative duration cannot be represented under this ISO 8601 policy: %w", ErrFormat) + } + + if !cfg.allowFraction && d%time.Second != 0 { + return "", fmt.Errorf("sub-second precision cannot be represented under this ISO 8601 policy: %w", ErrFormat) + } + + return isoFormat(d), nil +} + +// isoFormatFraction renders a nanosecond remainder (0..1e9) as its 9-digit fractional part with trailing zeros trimmed. +func isoFormatFraction(frac uint64) string { + s := strconv.FormatUint(frac, decimalBase) + if len(s) < nanoDigits { + s = strings.Repeat("0", nanoDigits-len(s)) + s + } + return strings.TrimRight(s, "0") +} diff --git a/vendor/github.com/go-openapi/strfmt/duration_iso8601_options.go b/vendor/github.com/go-openapi/strfmt/duration_iso8601_options.go new file mode 100644 index 0000000..4f90a5c --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/duration_iso8601_options.go @@ -0,0 +1,80 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +package strfmt + +// ISODurationPolicy is a compile-time policy selecting the parsing behaviour of an [ISODuration]. +// +// It is a phantom type parameter: a zero-size value whose single method yields the parser configuration. +// See [DurationStrict] and [DurationLenient]. +type ISODurationPolicy interface { + isoDurationConfig() isoDurationConfig +} + +// isoDurationConfig holds the leniency knobs of the ISO 8601 duration parser. +// +// The zero value is the strict RFC 3339 Appendix A grammar (the JSON Schema "duration" format): every field false. +type isoDurationConfig struct { + allowFraction bool // accept a decimal fraction on the least significant component + allowSign bool // accept a leading '+' or '-' + allowSpace bool // tolerate surrounding whitespace + weekCombinable bool // allow the 'W' designator to combine with other components + relaxAnchoring bool // allow gaps in the component chain (e.g. P1Y2D, PT1H2S) +} + +// DurationStrict is the strict RFC 3339 Appendix A policy. +// +// This is the grammar that the JSON Schema "duration" format is defined against (draft 2020): +// no fraction, no sign, no whitespace, strict ordering and anchoring, and an exclusive 'W' designator. +type DurationStrict struct{} + +func (DurationStrict) isoDurationConfig() isoDurationConfig { return isoDurationConfig{} } + +// DurationLenient relaxes every strictness knob. +// +// It accepts a decimal fraction on the least significant component, a leading sign, surrounding whitespace, +// component chains with gaps (e.g. P1Y2D), and a 'W' designator combined with other components. +// +// It remains ordered (P2D1Y is still rejected). +type DurationLenient struct{} + +func (DurationLenient) isoDurationConfig() isoDurationConfig { + return isoDurationConfig{ + allowFraction: true, + allowSign: true, + allowSpace: true, + weekCombinable: true, + relaxAnchoring: true, + } +} + +// ISODurationOption relaxes the strict parser on the explicit [ParseISO8601Duration] path, for programmatic callers. +// +// It has no effect on the registry / struct-field decode path, which is governed by the type's policy. +type ISODurationOption func(*isoDurationConfig) + +// WithISOFractions accepts a decimal fraction on the least significant component. +func WithISOFractions() ISODurationOption { + return func(c *isoDurationConfig) { c.allowFraction = true } +} + +// WithISOSign accepts a leading '+' or '-'. +func WithISOSign() ISODurationOption { return func(c *isoDurationConfig) { c.allowSign = true } } + +// WithISOSpace tolerates surrounding whitespace. +func WithISOSpace() ISODurationOption { return func(c *isoDurationConfig) { c.allowSpace = true } } + +// WithISOWeekCombinable allows the 'W' designator to combine with other components. +func WithISOWeekCombinable() ISODurationOption { + return func(c *isoDurationConfig) { c.weekCombinable = true } +} + +// WithISORelaxedAnchoring allows gaps in the component chain (e.g. P1Y2D, PT1H2S). +func WithISORelaxedAnchoring() ISODurationOption { + return func(c *isoDurationConfig) { c.relaxAnchoring = true } +} + +// WithISOLenient relaxes every strictness knob (see [DurationLenient]). +func WithISOLenient() ISODurationOption { + return func(c *isoDurationConfig) { *c = DurationLenient{}.isoDurationConfig() } +} diff --git a/vendor/github.com/go-openapi/strfmt/format.go b/vendor/github.com/go-openapi/strfmt/format.go index e494dd7..09c3754 100644 --- a/vendor/github.com/go-openapi/strfmt/format.go +++ b/vendor/github.com/go-openapi/strfmt/format.go @@ -10,15 +10,11 @@ import ( "slices" "strings" "sync" - "time" "github.com/go-openapi/errors" "github.com/go-viper/mapstructure/v2" ) -// Default is the default formats registry. -var Default = NewSeededFormats(nil, nil) //nolint:gochecknoglobals // package-level default registry, by design - // Validator represents a validator for a string format. type Validator func(string) bool @@ -48,11 +44,28 @@ type knownFormat struct { } // NameNormalizer is a function that normalizes a format name. +// +// The default duration format corresponds to "duration-human". type NameNormalizer func(string) string +var dashReplacer = strings.NewReplacer("-", "") //nolint:gochecknoglobals // it's okay to use a global private replacer + // DefaultNameNormalizer removes all dashes. func DefaultNameNormalizer(name string) string { - return strings.ReplaceAll(name, "-", "") + if name == "duration" { + name = "duration-human" + } + + return dashReplacer.Replace(name) +} + +// JSONSchema2020Normalizer is like [NameNormalizer] but adopts "duration-iso8601" as the default "duration" format. +func JSONSchema2020Normalizer(name string) string { + if name == "duration" { + name = "duration-iso8601" + } + + return dashReplacer.Replace(name) } type defaultFormats struct { @@ -63,6 +76,11 @@ type defaultFormats struct { } // MapStructureHookFunc is a decode hook function for mapstructure. +// +// A registered format is decoded by delegating to the destination type's own +// [encoding.TextUnmarshaler], so the mapstructure path is identical to the JSON +// and [defaultFormats.Parse] paths. New formats are picked up automatically as +// soon as they are registered — no per-type wiring here. func (f *defaultFormats) MapStructureHookFunc() mapstructure.DecodeHookFunc { //nolint:ireturn // returns interface required by mapstructure return func(from reflect.Type, to reflect.Type, obj any) (any, error) { if from.Kind() != reflect.String { @@ -74,85 +92,25 @@ func (f *defaultFormats) MapStructureHookFunc() mapstructure.DecodeHookFunc { // } for _, v := range f.data { - tpe, _ := f.GetType(v.Name) - if to == tpe { - return decodeFormatFromString(v.Name, data) + if to != v.Type { + continue } - } - return data, nil - } -} -// decodeFormatFromString decodes a string into the appropriate format type by name. -func decodeFormatFromString(name, data string) (any, error) { //nolint:gocyclo,cyclop // flat switch over format names, no real complexity - switch name { - case "date": - d, err := time.ParseInLocation(RFC3339FullDate, data, DefaultTimeLocation) - if err != nil { - return nil, err - } - return Date(d), nil - case "datetime": - if len(data) == 0 { - return nil, fmt.Errorf("empty string is an invalid datetime format: %w", ErrFormat) - } - return ParseDateTime(data) - case "duration": - dur, err := ParseDuration(data) - if err != nil { - return nil, err - } - return Duration(dur), nil - case "uri": - return URI(data), nil - case "email": - return Email(data), nil - case "uuid": - return UUID(data), nil - case "uuid3": - return UUID3(data), nil - case "uuid4": - return UUID4(data), nil - case "uuid5": - return UUID5(data), nil - case "uuid7": - return UUID7(data), nil - case "hostname": - return Hostname(data), nil - case "ipv4": - return IPv4(data), nil - case "ipv6": - return IPv6(data), nil - case "cidr": - return CIDR(data), nil - case "mac": - return MAC(data), nil - case "isbn": - return ISBN(data), nil - case "isbn10": - return ISBN10(data), nil - case "isbn13": - return ISBN13(data), nil - case "creditcard": - return CreditCard(data), nil - case "ssn": - return SSN(data), nil - case "hexcolor": - return HexColor(data), nil - case "rgbcolor": - return RGBColor(data), nil - case "byte": - return Base64(data), nil - case "password": - return Password(data), nil - case "ulid": - ulid, err := ParseULID(data) - if err != nil { - return nil, err + // reflect.New yields an addressable *T so the (pointer-receiver) + // TextUnmarshaler can hydrate it; we hand back the dereferenced + // value to match the destination field's (value) type. + nw := reflect.New(v.Type).Interface() + dec, isText := nw.(encoding.TextUnmarshaler) + if !isText { + return nil, errors.InvalidTypeName(v.Name) + } + if err := dec.UnmarshalText([]byte(data)); err != nil { + return nil, err + } + return reflect.ValueOf(nw).Elem().Interface(), nil } - return ulid, nil - default: - return nil, errors.InvalidTypeName(name) + + return data, nil } } diff --git a/vendor/github.com/go-openapi/strfmt/internal/countries/countries.go b/vendor/github.com/go-openapi/strfmt/internal/countries/countries.go new file mode 100644 index 0000000..7f13c0c --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/internal/countries/countries.go @@ -0,0 +1,512 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +// Code generated by gen.go; DO NOT EDIT. + +package countries + +// CountriesISO3 indexes ISO3166 countries by their alpha-3 code. +var CountriesISO3 = map[string]Country{ + "ABW": {Name: "Aruba", ISOAlpha3: "ABW", ISOAlpha2: "AW", Code: "533"}, + "AFG": {Name: "Afghanistan", ISOAlpha3: "AFG", ISOAlpha2: "AF", Code: "004"}, + "AGO": {Name: "Angola", ISOAlpha3: "AGO", ISOAlpha2: "AO", Code: "024"}, + "AIA": {Name: "Anguilla", ISOAlpha3: "AIA", ISOAlpha2: "AI", Code: "660"}, + "ALA": {Name: "Åland Islands", ISOAlpha3: "ALA", ISOAlpha2: "AX", Code: "248"}, + "ALB": {Name: "Albania", ISOAlpha3: "ALB", ISOAlpha2: "AL", Code: "008"}, + "AND": {Name: "Andorra", ISOAlpha3: "AND", ISOAlpha2: "AD", Code: "020"}, + "ARE": {Name: "United Arab Emirates", ISOAlpha3: "ARE", ISOAlpha2: "AE", Code: "784"}, + "ARG": {Name: "Argentina", ISOAlpha3: "ARG", ISOAlpha2: "AR", Code: "032"}, + "ARM": {Name: "Armenia", ISOAlpha3: "ARM", ISOAlpha2: "AM", Code: "051"}, + "ASM": {Name: "American Samoa", ISOAlpha3: "ASM", ISOAlpha2: "AS", Code: "016"}, + "ATA": {Name: "Antarctica", ISOAlpha3: "ATA", ISOAlpha2: "AQ", Code: "010"}, + "ATF": {Name: "French Southern Territories", ISOAlpha3: "ATF", ISOAlpha2: "TF", Code: "260"}, + "ATG": {Name: "Antigua and Barbuda", ISOAlpha3: "ATG", ISOAlpha2: "AG", Code: "028"}, + "AUS": {Name: "Australia", ISOAlpha3: "AUS", ISOAlpha2: "AU", Code: "036"}, + "AUT": {Name: "Austria", ISOAlpha3: "AUT", ISOAlpha2: "AT", Code: "040"}, + "AZE": {Name: "Azerbaijan", ISOAlpha3: "AZE", ISOAlpha2: "AZ", Code: "031"}, + "BDI": {Name: "Burundi", ISOAlpha3: "BDI", ISOAlpha2: "BI", Code: "108"}, + "BEL": {Name: "Belgium", ISOAlpha3: "BEL", ISOAlpha2: "BE", Code: "056"}, + "BEN": {Name: "Benin", ISOAlpha3: "BEN", ISOAlpha2: "BJ", Code: "204"}, + "BES": {Name: "Bonaire, Sint Eustatius and Saba", ISOAlpha3: "BES", ISOAlpha2: "BQ", Code: "535"}, + "BFA": {Name: "Burkina Faso", ISOAlpha3: "BFA", ISOAlpha2: "BF", Code: "854"}, + "BGD": {Name: "Bangladesh", ISOAlpha3: "BGD", ISOAlpha2: "BD", Code: "050"}, + "BGR": {Name: "Bulgaria", ISOAlpha3: "BGR", ISOAlpha2: "BG", Code: "100"}, + "BHR": {Name: "Bahrain", ISOAlpha3: "BHR", ISOAlpha2: "BH", Code: "048"}, + "BHS": {Name: "Bahamas", ISOAlpha3: "BHS", ISOAlpha2: "BS", Code: "044"}, + "BIH": {Name: "Bosnia and Herzegovina", ISOAlpha3: "BIH", ISOAlpha2: "BA", Code: "070"}, + "BLM": {Name: "Saint Barthélemy", ISOAlpha3: "BLM", ISOAlpha2: "BL", Code: "652"}, + "BLR": {Name: "Belarus", ISOAlpha3: "BLR", ISOAlpha2: "BY", Code: "112"}, + "BLZ": {Name: "Belize", ISOAlpha3: "BLZ", ISOAlpha2: "BZ", Code: "084"}, + "BMU": {Name: "Bermuda", ISOAlpha3: "BMU", ISOAlpha2: "BM", Code: "060"}, + "BOL": {Name: "Bolivia (Plurinational State of)", ISOAlpha3: "BOL", ISOAlpha2: "BO", Code: "068"}, + "BRA": {Name: "Brazil", ISOAlpha3: "BRA", ISOAlpha2: "BR", Code: "076"}, + "BRB": {Name: "Barbados", ISOAlpha3: "BRB", ISOAlpha2: "BB", Code: "052"}, + "BRN": {Name: "Brunei Darussalam", ISOAlpha3: "BRN", ISOAlpha2: "BN", Code: "096"}, + "BTN": {Name: "Bhutan", ISOAlpha3: "BTN", ISOAlpha2: "BT", Code: "064"}, + "BVT": {Name: "Bouvet Island", ISOAlpha3: "BVT", ISOAlpha2: "BV", Code: "074"}, + "BWA": {Name: "Botswana", ISOAlpha3: "BWA", ISOAlpha2: "BW", Code: "072"}, + "CAF": {Name: "Central African Republic", ISOAlpha3: "CAF", ISOAlpha2: "CF", Code: "140"}, + "CAN": {Name: "Canada", ISOAlpha3: "CAN", ISOAlpha2: "CA", Code: "124"}, + "CCK": {Name: "Cocos (Keeling) Islands", ISOAlpha3: "CCK", ISOAlpha2: "CC", Code: "166"}, + "CHE": {Name: "Switzerland", ISOAlpha3: "CHE", ISOAlpha2: "CH", Code: "756"}, + "CHL": {Name: "Chile", ISOAlpha3: "CHL", ISOAlpha2: "CL", Code: "152"}, + "CHN": {Name: "China", ISOAlpha3: "CHN", ISOAlpha2: "CN", Code: "156"}, + "CIV": {Name: "Côte d'Ivoire", ISOAlpha3: "CIV", ISOAlpha2: "CI", Code: "384"}, + "CMR": {Name: "Cameroon", ISOAlpha3: "CMR", ISOAlpha2: "CM", Code: "120"}, + "COD": {Name: "Congo, Democratic Republic of the", ISOAlpha3: "COD", ISOAlpha2: "CD", Code: "180"}, + "COG": {Name: "Congo", ISOAlpha3: "COG", ISOAlpha2: "CG", Code: "178"}, + "COK": {Name: "Cook Islands", ISOAlpha3: "COK", ISOAlpha2: "CK", Code: "184"}, + "COL": {Name: "Colombia", ISOAlpha3: "COL", ISOAlpha2: "CO", Code: "170"}, + "COM": {Name: "Comoros", ISOAlpha3: "COM", ISOAlpha2: "KM", Code: "174"}, + "CPV": {Name: "Cabo Verde", ISOAlpha3: "CPV", ISOAlpha2: "CV", Code: "132"}, + "CRI": {Name: "Costa Rica", ISOAlpha3: "CRI", ISOAlpha2: "CR", Code: "188"}, + "CUB": {Name: "Cuba", ISOAlpha3: "CUB", ISOAlpha2: "CU", Code: "192"}, + "CUW": {Name: "Curaçao", ISOAlpha3: "CUW", ISOAlpha2: "CW", Code: "531"}, + "CXR": {Name: "Christmas Island", ISOAlpha3: "CXR", ISOAlpha2: "CX", Code: "162"}, + "CYM": {Name: "Cayman Islands", ISOAlpha3: "CYM", ISOAlpha2: "KY", Code: "136"}, + "CYP": {Name: "Cyprus", ISOAlpha3: "CYP", ISOAlpha2: "CY", Code: "196"}, + "CZE": {Name: "Czechia", ISOAlpha3: "CZE", ISOAlpha2: "CZ", Code: "203"}, + "DEU": {Name: "Germany", ISOAlpha3: "DEU", ISOAlpha2: "DE", Code: "276"}, + "DJI": {Name: "Djibouti", ISOAlpha3: "DJI", ISOAlpha2: "DJ", Code: "262"}, + "DMA": {Name: "Dominica", ISOAlpha3: "DMA", ISOAlpha2: "DM", Code: "212"}, + "DNK": {Name: "Denmark", ISOAlpha3: "DNK", ISOAlpha2: "DK", Code: "208"}, + "DOM": {Name: "Dominican Republic", ISOAlpha3: "DOM", ISOAlpha2: "DO", Code: "214"}, + "DZA": {Name: "Algeria", ISOAlpha3: "DZA", ISOAlpha2: "DZ", Code: "012"}, + "ECU": {Name: "Ecuador", ISOAlpha3: "ECU", ISOAlpha2: "EC", Code: "218"}, + "EGY": {Name: "Egypt", ISOAlpha3: "EGY", ISOAlpha2: "EG", Code: "818"}, + "ERI": {Name: "Eritrea", ISOAlpha3: "ERI", ISOAlpha2: "ER", Code: "232"}, + "ESH": {Name: "Western Sahara", ISOAlpha3: "ESH", ISOAlpha2: "EH", Code: "732"}, + "ESP": {Name: "Spain", ISOAlpha3: "ESP", ISOAlpha2: "ES", Code: "724"}, + "EST": {Name: "Estonia", ISOAlpha3: "EST", ISOAlpha2: "EE", Code: "233"}, + "ETH": {Name: "Ethiopia", ISOAlpha3: "ETH", ISOAlpha2: "ET", Code: "231"}, + "FIN": {Name: "Finland", ISOAlpha3: "FIN", ISOAlpha2: "FI", Code: "246"}, + "FJI": {Name: "Fiji", ISOAlpha3: "FJI", ISOAlpha2: "FJ", Code: "242"}, + "FLK": {Name: "Falkland Islands (Malvinas)", ISOAlpha3: "FLK", ISOAlpha2: "FK", Code: "238"}, + "FRA": {Name: "France", ISOAlpha3: "FRA", ISOAlpha2: "FR", Code: "250"}, + "FRO": {Name: "Faroe Islands", ISOAlpha3: "FRO", ISOAlpha2: "FO", Code: "234"}, + "FSM": {Name: "Micronesia (Federated States of)", ISOAlpha3: "FSM", ISOAlpha2: "FM", Code: "583"}, + "GAB": {Name: "Gabon", ISOAlpha3: "GAB", ISOAlpha2: "GA", Code: "266"}, + "GBR": {Name: "United Kingdom of Great Britain and Northern Ireland", ISOAlpha3: "GBR", ISOAlpha2: "GB", Code: "826"}, + "GEO": {Name: "Georgia", ISOAlpha3: "GEO", ISOAlpha2: "GE", Code: "268"}, + "GGY": {Name: "Guernsey", ISOAlpha3: "GGY", ISOAlpha2: "GG", Code: "831"}, + "GHA": {Name: "Ghana", ISOAlpha3: "GHA", ISOAlpha2: "GH", Code: "288"}, + "GIB": {Name: "Gibraltar", ISOAlpha3: "GIB", ISOAlpha2: "GI", Code: "292"}, + "GIN": {Name: "Guinea", ISOAlpha3: "GIN", ISOAlpha2: "GN", Code: "324"}, + "GLP": {Name: "Guadeloupe", ISOAlpha3: "GLP", ISOAlpha2: "GP", Code: "312"}, + "GMB": {Name: "Gambia", ISOAlpha3: "GMB", ISOAlpha2: "GM", Code: "270"}, + "GNB": {Name: "Guinea-Bissau", ISOAlpha3: "GNB", ISOAlpha2: "GW", Code: "624"}, + "GNQ": {Name: "Equatorial Guinea", ISOAlpha3: "GNQ", ISOAlpha2: "GQ", Code: "226"}, + "GRC": {Name: "Greece", ISOAlpha3: "GRC", ISOAlpha2: "GR", Code: "300"}, + "GRD": {Name: "Grenada", ISOAlpha3: "GRD", ISOAlpha2: "GD", Code: "308"}, + "GRL": {Name: "Greenland", ISOAlpha3: "GRL", ISOAlpha2: "GL", Code: "304"}, + "GTM": {Name: "Guatemala", ISOAlpha3: "GTM", ISOAlpha2: "GT", Code: "320"}, + "GUF": {Name: "French Guiana", ISOAlpha3: "GUF", ISOAlpha2: "GF", Code: "254"}, + "GUM": {Name: "Guam", ISOAlpha3: "GUM", ISOAlpha2: "GU", Code: "316"}, + "GUY": {Name: "Guyana", ISOAlpha3: "GUY", ISOAlpha2: "GY", Code: "328"}, + "HKG": {Name: "Hong Kong", ISOAlpha3: "HKG", ISOAlpha2: "HK", Code: "344"}, + "HMD": {Name: "Heard Island and McDonald Islands", ISOAlpha3: "HMD", ISOAlpha2: "HM", Code: "334"}, + "HND": {Name: "Honduras", ISOAlpha3: "HND", ISOAlpha2: "HN", Code: "340"}, + "HRV": {Name: "Croatia", ISOAlpha3: "HRV", ISOAlpha2: "HR", Code: "191"}, + "HTI": {Name: "Haiti", ISOAlpha3: "HTI", ISOAlpha2: "HT", Code: "332"}, + "HUN": {Name: "Hungary", ISOAlpha3: "HUN", ISOAlpha2: "HU", Code: "348"}, + "IDN": {Name: "Indonesia", ISOAlpha3: "IDN", ISOAlpha2: "ID", Code: "360"}, + "IMN": {Name: "Isle of Man", ISOAlpha3: "IMN", ISOAlpha2: "IM", Code: "833"}, + "IND": {Name: "India", ISOAlpha3: "IND", ISOAlpha2: "IN", Code: "356"}, + "IOT": {Name: "British Indian Ocean Territory", ISOAlpha3: "IOT", ISOAlpha2: "IO", Code: "086"}, + "IRL": {Name: "Ireland", ISOAlpha3: "IRL", ISOAlpha2: "IE", Code: "372"}, + "IRN": {Name: "Iran (Islamic Republic of)", ISOAlpha3: "IRN", ISOAlpha2: "IR", Code: "364"}, + "IRQ": {Name: "Iraq", ISOAlpha3: "IRQ", ISOAlpha2: "IQ", Code: "368"}, + "ISL": {Name: "Iceland", ISOAlpha3: "ISL", ISOAlpha2: "IS", Code: "352"}, + "ISR": {Name: "Israel", ISOAlpha3: "ISR", ISOAlpha2: "IL", Code: "376"}, + "ITA": {Name: "Italy", ISOAlpha3: "ITA", ISOAlpha2: "IT", Code: "380"}, + "JAM": {Name: "Jamaica", ISOAlpha3: "JAM", ISOAlpha2: "JM", Code: "388"}, + "JEY": {Name: "Jersey", ISOAlpha3: "JEY", ISOAlpha2: "JE", Code: "832"}, + "JOR": {Name: "Jordan", ISOAlpha3: "JOR", ISOAlpha2: "JO", Code: "400"}, + "JPN": {Name: "Japan", ISOAlpha3: "JPN", ISOAlpha2: "JP", Code: "392"}, + "KAZ": {Name: "Kazakhstan", ISOAlpha3: "KAZ", ISOAlpha2: "KZ", Code: "398"}, + "KEN": {Name: "Kenya", ISOAlpha3: "KEN", ISOAlpha2: "KE", Code: "404"}, + "KGZ": {Name: "Kyrgyzstan", ISOAlpha3: "KGZ", ISOAlpha2: "KG", Code: "417"}, + "KHM": {Name: "Cambodia", ISOAlpha3: "KHM", ISOAlpha2: "KH", Code: "116"}, + "KIR": {Name: "Kiribati", ISOAlpha3: "KIR", ISOAlpha2: "KI", Code: "296"}, + "KNA": {Name: "Saint Kitts and Nevis", ISOAlpha3: "KNA", ISOAlpha2: "KN", Code: "659"}, + "KOR": {Name: "Korea, Republic of", ISOAlpha3: "KOR", ISOAlpha2: "KR", Code: "410"}, + "KWT": {Name: "Kuwait", ISOAlpha3: "KWT", ISOAlpha2: "KW", Code: "414"}, + "LAO": {Name: "Lao People's Democratic Republic", ISOAlpha3: "LAO", ISOAlpha2: "LA", Code: "418"}, + "LBN": {Name: "Lebanon", ISOAlpha3: "LBN", ISOAlpha2: "LB", Code: "422"}, + "LBR": {Name: "Liberia", ISOAlpha3: "LBR", ISOAlpha2: "LR", Code: "430"}, + "LBY": {Name: "Libya", ISOAlpha3: "LBY", ISOAlpha2: "LY", Code: "434"}, + "LCA": {Name: "Saint Lucia", ISOAlpha3: "LCA", ISOAlpha2: "LC", Code: "662"}, + "LIE": {Name: "Liechtenstein", ISOAlpha3: "LIE", ISOAlpha2: "LI", Code: "438"}, + "LKA": {Name: "Sri Lanka", ISOAlpha3: "LKA", ISOAlpha2: "LK", Code: "144"}, + "LSO": {Name: "Lesotho", ISOAlpha3: "LSO", ISOAlpha2: "LS", Code: "426"}, + "LTU": {Name: "Lithuania", ISOAlpha3: "LTU", ISOAlpha2: "LT", Code: "440"}, + "LUX": {Name: "Luxembourg", ISOAlpha3: "LUX", ISOAlpha2: "LU", Code: "442"}, + "LVA": {Name: "Latvia", ISOAlpha3: "LVA", ISOAlpha2: "LV", Code: "428"}, + "MAC": {Name: "Macao", ISOAlpha3: "MAC", ISOAlpha2: "MO", Code: "446"}, + "MAF": {Name: "Saint Martin (French part)", ISOAlpha3: "MAF", ISOAlpha2: "MF", Code: "663"}, + "MAR": {Name: "Morocco", ISOAlpha3: "MAR", ISOAlpha2: "MA", Code: "504"}, + "MCO": {Name: "Monaco", ISOAlpha3: "MCO", ISOAlpha2: "MC", Code: "492"}, + "MDA": {Name: "Moldova, Republic of", ISOAlpha3: "MDA", ISOAlpha2: "MD", Code: "498"}, + "MDG": {Name: "Madagascar", ISOAlpha3: "MDG", ISOAlpha2: "MG", Code: "450"}, + "MDV": {Name: "Maldives", ISOAlpha3: "MDV", ISOAlpha2: "MV", Code: "462"}, + "MEX": {Name: "Mexico", ISOAlpha3: "MEX", ISOAlpha2: "MX", Code: "484"}, + "MHL": {Name: "Marshall Islands", ISOAlpha3: "MHL", ISOAlpha2: "MH", Code: "584"}, + "MKD": {Name: "North Macedonia", ISOAlpha3: "MKD", ISOAlpha2: "MK", Code: "807"}, + "MLI": {Name: "Mali", ISOAlpha3: "MLI", ISOAlpha2: "ML", Code: "466"}, + "MLT": {Name: "Malta", ISOAlpha3: "MLT", ISOAlpha2: "MT", Code: "470"}, + "MMR": {Name: "Myanmar", ISOAlpha3: "MMR", ISOAlpha2: "MM", Code: "104"}, + "MNE": {Name: "Montenegro", ISOAlpha3: "MNE", ISOAlpha2: "ME", Code: "499"}, + "MNG": {Name: "Mongolia", ISOAlpha3: "MNG", ISOAlpha2: "MN", Code: "496"}, + "MNP": {Name: "Northern Mariana Islands", ISOAlpha3: "MNP", ISOAlpha2: "MP", Code: "580"}, + "MOZ": {Name: "Mozambique", ISOAlpha3: "MOZ", ISOAlpha2: "MZ", Code: "508"}, + "MRT": {Name: "Mauritania", ISOAlpha3: "MRT", ISOAlpha2: "MR", Code: "478"}, + "MSR": {Name: "Montserrat", ISOAlpha3: "MSR", ISOAlpha2: "MS", Code: "500"}, + "MTQ": {Name: "Martinique", ISOAlpha3: "MTQ", ISOAlpha2: "MQ", Code: "474"}, + "MUS": {Name: "Mauritius", ISOAlpha3: "MUS", ISOAlpha2: "MU", Code: "480"}, + "MWI": {Name: "Malawi", ISOAlpha3: "MWI", ISOAlpha2: "MW", Code: "454"}, + "MYS": {Name: "Malaysia", ISOAlpha3: "MYS", ISOAlpha2: "MY", Code: "458"}, + "MYT": {Name: "Mayotte", ISOAlpha3: "MYT", ISOAlpha2: "YT", Code: "175"}, + "NAM": {Name: "Namibia", ISOAlpha3: "NAM", ISOAlpha2: "NA", Code: "516"}, + "NCL": {Name: "New Caledonia", ISOAlpha3: "NCL", ISOAlpha2: "NC", Code: "540"}, + "NER": {Name: "Niger", ISOAlpha3: "NER", ISOAlpha2: "NE", Code: "562"}, + "NFK": {Name: "Norfolk Island", ISOAlpha3: "NFK", ISOAlpha2: "NF", Code: "574"}, + "NGA": {Name: "Nigeria", ISOAlpha3: "NGA", ISOAlpha2: "NG", Code: "566"}, + "NIC": {Name: "Nicaragua", ISOAlpha3: "NIC", ISOAlpha2: "NI", Code: "558"}, + "NIU": {Name: "Niue", ISOAlpha3: "NIU", ISOAlpha2: "NU", Code: "570"}, + "NLD": {Name: "Netherlands", ISOAlpha3: "NLD", ISOAlpha2: "NL", Code: "528"}, + "NOR": {Name: "Norway", ISOAlpha3: "NOR", ISOAlpha2: "NO", Code: "578"}, + "NPL": {Name: "Nepal", ISOAlpha3: "NPL", ISOAlpha2: "NP", Code: "524"}, + "NRU": {Name: "Nauru", ISOAlpha3: "NRU", ISOAlpha2: "NR", Code: "520"}, + "NZL": {Name: "New Zealand", ISOAlpha3: "NZL", ISOAlpha2: "NZ", Code: "554"}, + "OMN": {Name: "Oman", ISOAlpha3: "OMN", ISOAlpha2: "OM", Code: "512"}, + "PAK": {Name: "Pakistan", ISOAlpha3: "PAK", ISOAlpha2: "PK", Code: "586"}, + "PAN": {Name: "Panama", ISOAlpha3: "PAN", ISOAlpha2: "PA", Code: "591"}, + "PCN": {Name: "Pitcairn", ISOAlpha3: "PCN", ISOAlpha2: "PN", Code: "612"}, + "PER": {Name: "Peru", ISOAlpha3: "PER", ISOAlpha2: "PE", Code: "604"}, + "PHL": {Name: "Philippines", ISOAlpha3: "PHL", ISOAlpha2: "PH", Code: "608"}, + "PLW": {Name: "Palau", ISOAlpha3: "PLW", ISOAlpha2: "PW", Code: "585"}, + "PNG": {Name: "Papua New Guinea", ISOAlpha3: "PNG", ISOAlpha2: "PG", Code: "598"}, + "POL": {Name: "Poland", ISOAlpha3: "POL", ISOAlpha2: "PL", Code: "616"}, + "PRI": {Name: "Puerto Rico", ISOAlpha3: "PRI", ISOAlpha2: "PR", Code: "630"}, + "PRK": {Name: "Korea (Democratic People's Republic of)", ISOAlpha3: "PRK", ISOAlpha2: "KP", Code: "408"}, + "PRT": {Name: "Portugal", ISOAlpha3: "PRT", ISOAlpha2: "PT", Code: "620"}, + "PRY": {Name: "Paraguay", ISOAlpha3: "PRY", ISOAlpha2: "PY", Code: "600"}, + "PSE": {Name: "Palestine, State of", ISOAlpha3: "PSE", ISOAlpha2: "PS", Code: "275"}, + "PYF": {Name: "French Polynesia", ISOAlpha3: "PYF", ISOAlpha2: "PF", Code: "258"}, + "QAT": {Name: "Qatar", ISOAlpha3: "QAT", ISOAlpha2: "QA", Code: "634"}, + "REU": {Name: "Réunion", ISOAlpha3: "REU", ISOAlpha2: "RE", Code: "638"}, + "ROU": {Name: "Romania", ISOAlpha3: "ROU", ISOAlpha2: "RO", Code: "642"}, + "RUS": {Name: "Russian Federation", ISOAlpha3: "RUS", ISOAlpha2: "RU", Code: "643"}, + "RWA": {Name: "Rwanda", ISOAlpha3: "RWA", ISOAlpha2: "RW", Code: "646"}, + "SAU": {Name: "Saudi Arabia", ISOAlpha3: "SAU", ISOAlpha2: "SA", Code: "682"}, + "SDN": {Name: "Sudan", ISOAlpha3: "SDN", ISOAlpha2: "SD", Code: "729"}, + "SEN": {Name: "Senegal", ISOAlpha3: "SEN", ISOAlpha2: "SN", Code: "686"}, + "SGP": {Name: "Singapore", ISOAlpha3: "SGP", ISOAlpha2: "SG", Code: "702"}, + "SGS": {Name: "South Georgia and the South Sandwich Islands", ISOAlpha3: "SGS", ISOAlpha2: "GS", Code: "239"}, + "SHN": {Name: "Saint Helena, Ascension and Tristan da Cunha", ISOAlpha3: "SHN", ISOAlpha2: "SH", Code: "654"}, + "SJM": {Name: "Svalbard and Jan Mayen", ISOAlpha3: "SJM", ISOAlpha2: "SJ", Code: "744"}, + "SLB": {Name: "Solomon Islands", ISOAlpha3: "SLB", ISOAlpha2: "SB", Code: "090"}, + "SLE": {Name: "Sierra Leone", ISOAlpha3: "SLE", ISOAlpha2: "SL", Code: "694"}, + "SLV": {Name: "El Salvador", ISOAlpha3: "SLV", ISOAlpha2: "SV", Code: "222"}, + "SMR": {Name: "San Marino", ISOAlpha3: "SMR", ISOAlpha2: "SM", Code: "674"}, + "SOM": {Name: "Somalia", ISOAlpha3: "SOM", ISOAlpha2: "SO", Code: "706"}, + "SPM": {Name: "Saint Pierre and Miquelon", ISOAlpha3: "SPM", ISOAlpha2: "PM", Code: "666"}, + "SRB": {Name: "Serbia", ISOAlpha3: "SRB", ISOAlpha2: "RS", Code: "688"}, + "SSD": {Name: "South Sudan", ISOAlpha3: "SSD", ISOAlpha2: "SS", Code: "728"}, + "STP": {Name: "Sao Tome and Principe", ISOAlpha3: "STP", ISOAlpha2: "ST", Code: "678"}, + "SUR": {Name: "Suriname", ISOAlpha3: "SUR", ISOAlpha2: "SR", Code: "740"}, + "SVK": {Name: "Slovakia", ISOAlpha3: "SVK", ISOAlpha2: "SK", Code: "703"}, + "SVN": {Name: "Slovenia", ISOAlpha3: "SVN", ISOAlpha2: "SI", Code: "705"}, + "SWE": {Name: "Sweden", ISOAlpha3: "SWE", ISOAlpha2: "SE", Code: "752"}, + "SWZ": {Name: "Eswatini", ISOAlpha3: "SWZ", ISOAlpha2: "SZ", Code: "748"}, + "SXM": {Name: "Sint Maarten (Dutch part)", ISOAlpha3: "SXM", ISOAlpha2: "SX", Code: "534"}, + "SYC": {Name: "Seychelles", ISOAlpha3: "SYC", ISOAlpha2: "SC", Code: "690"}, + "SYR": {Name: "Syrian Arab Republic", ISOAlpha3: "SYR", ISOAlpha2: "SY", Code: "760"}, + "TCA": {Name: "Turks and Caicos Islands", ISOAlpha3: "TCA", ISOAlpha2: "TC", Code: "796"}, + "TCD": {Name: "Chad", ISOAlpha3: "TCD", ISOAlpha2: "TD", Code: "148"}, + "TGO": {Name: "Togo", ISOAlpha3: "TGO", ISOAlpha2: "TG", Code: "768"}, + "THA": {Name: "Thailand", ISOAlpha3: "THA", ISOAlpha2: "TH", Code: "764"}, + "TJK": {Name: "Tajikistan", ISOAlpha3: "TJK", ISOAlpha2: "TJ", Code: "762"}, + "TKL": {Name: "Tokelau", ISOAlpha3: "TKL", ISOAlpha2: "TK", Code: "772"}, + "TKM": {Name: "Turkmenistan", ISOAlpha3: "TKM", ISOAlpha2: "TM", Code: "795"}, + "TLS": {Name: "Timor-Leste", ISOAlpha3: "TLS", ISOAlpha2: "TL", Code: "626"}, + "TON": {Name: "Tonga", ISOAlpha3: "TON", ISOAlpha2: "TO", Code: "776"}, + "TTO": {Name: "Trinidad and Tobago", ISOAlpha3: "TTO", ISOAlpha2: "TT", Code: "780"}, + "TUN": {Name: "Tunisia", ISOAlpha3: "TUN", ISOAlpha2: "TN", Code: "788"}, + "TUR": {Name: "Turkey", ISOAlpha3: "TUR", ISOAlpha2: "TR", Code: "792"}, + "TUV": {Name: "Tuvalu", ISOAlpha3: "TUV", ISOAlpha2: "TV", Code: "798"}, + "TWN": {Name: "Taiwan, Province of China", ISOAlpha3: "TWN", ISOAlpha2: "TW", Code: "158"}, + "TZA": {Name: "Tanzania, United Republic of", ISOAlpha3: "TZA", ISOAlpha2: "TZ", Code: "834"}, + "UGA": {Name: "Uganda", ISOAlpha3: "UGA", ISOAlpha2: "UG", Code: "800"}, + "UKR": {Name: "Ukraine", ISOAlpha3: "UKR", ISOAlpha2: "UA", Code: "804"}, + "UMI": {Name: "United States Minor Outlying Islands", ISOAlpha3: "UMI", ISOAlpha2: "UM", Code: "581"}, + "URY": {Name: "Uruguay", ISOAlpha3: "URY", ISOAlpha2: "UY", Code: "858"}, + "USA": {Name: "United States of America", ISOAlpha3: "USA", ISOAlpha2: "US", Code: "840"}, + "UZB": {Name: "Uzbekistan", ISOAlpha3: "UZB", ISOAlpha2: "UZ", Code: "860"}, + "VAT": {Name: "Holy See", ISOAlpha3: "VAT", ISOAlpha2: "VA", Code: "336"}, + "VCT": {Name: "Saint Vincent and the Grenadines", ISOAlpha3: "VCT", ISOAlpha2: "VC", Code: "670"}, + "VEN": {Name: "Venezuela (Bolivarian Republic of)", ISOAlpha3: "VEN", ISOAlpha2: "VE", Code: "862"}, + "VGB": {Name: "Virgin Islands (British)", ISOAlpha3: "VGB", ISOAlpha2: "VG", Code: "092"}, + "VIR": {Name: "Virgin Islands (U.S.)", ISOAlpha3: "VIR", ISOAlpha2: "VI", Code: "850"}, + "VNM": {Name: "Viet Nam", ISOAlpha3: "VNM", ISOAlpha2: "VN", Code: "704"}, + "VUT": {Name: "Vanuatu", ISOAlpha3: "VUT", ISOAlpha2: "VU", Code: "548"}, + "WLF": {Name: "Wallis and Futuna", ISOAlpha3: "WLF", ISOAlpha2: "WF", Code: "876"}, + "WSM": {Name: "Samoa", ISOAlpha3: "WSM", ISOAlpha2: "WS", Code: "882"}, + "YEM": {Name: "Yemen", ISOAlpha3: "YEM", ISOAlpha2: "YE", Code: "887"}, + "ZAF": {Name: "South Africa", ISOAlpha3: "ZAF", ISOAlpha2: "ZA", Code: "710"}, + "ZMB": {Name: "Zambia", ISOAlpha3: "ZMB", ISOAlpha2: "ZM", Code: "894"}, + "ZWE": {Name: "Zimbabwe", ISOAlpha3: "ZWE", ISOAlpha2: "ZW", Code: "716"}, +} + +// CountriesISO2 indexes ISO3166 countries by their alpha-2 code. +var CountriesISO2 = map[string]Country{ + "AD": {Name: "Andorra", ISOAlpha3: "AND", ISOAlpha2: "AD", Code: "020"}, + "AE": {Name: "United Arab Emirates", ISOAlpha3: "ARE", ISOAlpha2: "AE", Code: "784"}, + "AF": {Name: "Afghanistan", ISOAlpha3: "AFG", ISOAlpha2: "AF", Code: "004"}, + "AG": {Name: "Antigua and Barbuda", ISOAlpha3: "ATG", ISOAlpha2: "AG", Code: "028"}, + "AI": {Name: "Anguilla", ISOAlpha3: "AIA", ISOAlpha2: "AI", Code: "660"}, + "AL": {Name: "Albania", ISOAlpha3: "ALB", ISOAlpha2: "AL", Code: "008"}, + "AM": {Name: "Armenia", ISOAlpha3: "ARM", ISOAlpha2: "AM", Code: "051"}, + "AO": {Name: "Angola", ISOAlpha3: "AGO", ISOAlpha2: "AO", Code: "024"}, + "AQ": {Name: "Antarctica", ISOAlpha3: "ATA", ISOAlpha2: "AQ", Code: "010"}, + "AR": {Name: "Argentina", ISOAlpha3: "ARG", ISOAlpha2: "AR", Code: "032"}, + "AS": {Name: "American Samoa", ISOAlpha3: "ASM", ISOAlpha2: "AS", Code: "016"}, + "AT": {Name: "Austria", ISOAlpha3: "AUT", ISOAlpha2: "AT", Code: "040"}, + "AU": {Name: "Australia", ISOAlpha3: "AUS", ISOAlpha2: "AU", Code: "036"}, + "AW": {Name: "Aruba", ISOAlpha3: "ABW", ISOAlpha2: "AW", Code: "533"}, + "AX": {Name: "Åland Islands", ISOAlpha3: "ALA", ISOAlpha2: "AX", Code: "248"}, + "AZ": {Name: "Azerbaijan", ISOAlpha3: "AZE", ISOAlpha2: "AZ", Code: "031"}, + "BA": {Name: "Bosnia and Herzegovina", ISOAlpha3: "BIH", ISOAlpha2: "BA", Code: "070"}, + "BB": {Name: "Barbados", ISOAlpha3: "BRB", ISOAlpha2: "BB", Code: "052"}, + "BD": {Name: "Bangladesh", ISOAlpha3: "BGD", ISOAlpha2: "BD", Code: "050"}, + "BE": {Name: "Belgium", ISOAlpha3: "BEL", ISOAlpha2: "BE", Code: "056"}, + "BF": {Name: "Burkina Faso", ISOAlpha3: "BFA", ISOAlpha2: "BF", Code: "854"}, + "BG": {Name: "Bulgaria", ISOAlpha3: "BGR", ISOAlpha2: "BG", Code: "100"}, + "BH": {Name: "Bahrain", ISOAlpha3: "BHR", ISOAlpha2: "BH", Code: "048"}, + "BI": {Name: "Burundi", ISOAlpha3: "BDI", ISOAlpha2: "BI", Code: "108"}, + "BJ": {Name: "Benin", ISOAlpha3: "BEN", ISOAlpha2: "BJ", Code: "204"}, + "BL": {Name: "Saint Barthélemy", ISOAlpha3: "BLM", ISOAlpha2: "BL", Code: "652"}, + "BM": {Name: "Bermuda", ISOAlpha3: "BMU", ISOAlpha2: "BM", Code: "060"}, + "BN": {Name: "Brunei Darussalam", ISOAlpha3: "BRN", ISOAlpha2: "BN", Code: "096"}, + "BO": {Name: "Bolivia (Plurinational State of)", ISOAlpha3: "BOL", ISOAlpha2: "BO", Code: "068"}, + "BQ": {Name: "Bonaire, Sint Eustatius and Saba", ISOAlpha3: "BES", ISOAlpha2: "BQ", Code: "535"}, + "BR": {Name: "Brazil", ISOAlpha3: "BRA", ISOAlpha2: "BR", Code: "076"}, + "BS": {Name: "Bahamas", ISOAlpha3: "BHS", ISOAlpha2: "BS", Code: "044"}, + "BT": {Name: "Bhutan", ISOAlpha3: "BTN", ISOAlpha2: "BT", Code: "064"}, + "BV": {Name: "Bouvet Island", ISOAlpha3: "BVT", ISOAlpha2: "BV", Code: "074"}, + "BW": {Name: "Botswana", ISOAlpha3: "BWA", ISOAlpha2: "BW", Code: "072"}, + "BY": {Name: "Belarus", ISOAlpha3: "BLR", ISOAlpha2: "BY", Code: "112"}, + "BZ": {Name: "Belize", ISOAlpha3: "BLZ", ISOAlpha2: "BZ", Code: "084"}, + "CA": {Name: "Canada", ISOAlpha3: "CAN", ISOAlpha2: "CA", Code: "124"}, + "CC": {Name: "Cocos (Keeling) Islands", ISOAlpha3: "CCK", ISOAlpha2: "CC", Code: "166"}, + "CD": {Name: "Congo, Democratic Republic of the", ISOAlpha3: "COD", ISOAlpha2: "CD", Code: "180"}, + "CF": {Name: "Central African Republic", ISOAlpha3: "CAF", ISOAlpha2: "CF", Code: "140"}, + "CG": {Name: "Congo", ISOAlpha3: "COG", ISOAlpha2: "CG", Code: "178"}, + "CH": {Name: "Switzerland", ISOAlpha3: "CHE", ISOAlpha2: "CH", Code: "756"}, + "CI": {Name: "Côte d'Ivoire", ISOAlpha3: "CIV", ISOAlpha2: "CI", Code: "384"}, + "CK": {Name: "Cook Islands", ISOAlpha3: "COK", ISOAlpha2: "CK", Code: "184"}, + "CL": {Name: "Chile", ISOAlpha3: "CHL", ISOAlpha2: "CL", Code: "152"}, + "CM": {Name: "Cameroon", ISOAlpha3: "CMR", ISOAlpha2: "CM", Code: "120"}, + "CN": {Name: "China", ISOAlpha3: "CHN", ISOAlpha2: "CN", Code: "156"}, + "CO": {Name: "Colombia", ISOAlpha3: "COL", ISOAlpha2: "CO", Code: "170"}, + "CR": {Name: "Costa Rica", ISOAlpha3: "CRI", ISOAlpha2: "CR", Code: "188"}, + "CU": {Name: "Cuba", ISOAlpha3: "CUB", ISOAlpha2: "CU", Code: "192"}, + "CV": {Name: "Cabo Verde", ISOAlpha3: "CPV", ISOAlpha2: "CV", Code: "132"}, + "CW": {Name: "Curaçao", ISOAlpha3: "CUW", ISOAlpha2: "CW", Code: "531"}, + "CX": {Name: "Christmas Island", ISOAlpha3: "CXR", ISOAlpha2: "CX", Code: "162"}, + "CY": {Name: "Cyprus", ISOAlpha3: "CYP", ISOAlpha2: "CY", Code: "196"}, + "CZ": {Name: "Czechia", ISOAlpha3: "CZE", ISOAlpha2: "CZ", Code: "203"}, + "DE": {Name: "Germany", ISOAlpha3: "DEU", ISOAlpha2: "DE", Code: "276"}, + "DJ": {Name: "Djibouti", ISOAlpha3: "DJI", ISOAlpha2: "DJ", Code: "262"}, + "DK": {Name: "Denmark", ISOAlpha3: "DNK", ISOAlpha2: "DK", Code: "208"}, + "DM": {Name: "Dominica", ISOAlpha3: "DMA", ISOAlpha2: "DM", Code: "212"}, + "DO": {Name: "Dominican Republic", ISOAlpha3: "DOM", ISOAlpha2: "DO", Code: "214"}, + "DZ": {Name: "Algeria", ISOAlpha3: "DZA", ISOAlpha2: "DZ", Code: "012"}, + "EC": {Name: "Ecuador", ISOAlpha3: "ECU", ISOAlpha2: "EC", Code: "218"}, + "EE": {Name: "Estonia", ISOAlpha3: "EST", ISOAlpha2: "EE", Code: "233"}, + "EG": {Name: "Egypt", ISOAlpha3: "EGY", ISOAlpha2: "EG", Code: "818"}, + "EH": {Name: "Western Sahara", ISOAlpha3: "ESH", ISOAlpha2: "EH", Code: "732"}, + "ER": {Name: "Eritrea", ISOAlpha3: "ERI", ISOAlpha2: "ER", Code: "232"}, + "ES": {Name: "Spain", ISOAlpha3: "ESP", ISOAlpha2: "ES", Code: "724"}, + "ET": {Name: "Ethiopia", ISOAlpha3: "ETH", ISOAlpha2: "ET", Code: "231"}, + "FI": {Name: "Finland", ISOAlpha3: "FIN", ISOAlpha2: "FI", Code: "246"}, + "FJ": {Name: "Fiji", ISOAlpha3: "FJI", ISOAlpha2: "FJ", Code: "242"}, + "FK": {Name: "Falkland Islands (Malvinas)", ISOAlpha3: "FLK", ISOAlpha2: "FK", Code: "238"}, + "FM": {Name: "Micronesia (Federated States of)", ISOAlpha3: "FSM", ISOAlpha2: "FM", Code: "583"}, + "FO": {Name: "Faroe Islands", ISOAlpha3: "FRO", ISOAlpha2: "FO", Code: "234"}, + "FR": {Name: "France", ISOAlpha3: "FRA", ISOAlpha2: "FR", Code: "250"}, + "GA": {Name: "Gabon", ISOAlpha3: "GAB", ISOAlpha2: "GA", Code: "266"}, + "GB": {Name: "United Kingdom of Great Britain and Northern Ireland", ISOAlpha3: "GBR", ISOAlpha2: "GB", Code: "826"}, + "GD": {Name: "Grenada", ISOAlpha3: "GRD", ISOAlpha2: "GD", Code: "308"}, + "GE": {Name: "Georgia", ISOAlpha3: "GEO", ISOAlpha2: "GE", Code: "268"}, + "GF": {Name: "French Guiana", ISOAlpha3: "GUF", ISOAlpha2: "GF", Code: "254"}, + "GG": {Name: "Guernsey", ISOAlpha3: "GGY", ISOAlpha2: "GG", Code: "831"}, + "GH": {Name: "Ghana", ISOAlpha3: "GHA", ISOAlpha2: "GH", Code: "288"}, + "GI": {Name: "Gibraltar", ISOAlpha3: "GIB", ISOAlpha2: "GI", Code: "292"}, + "GL": {Name: "Greenland", ISOAlpha3: "GRL", ISOAlpha2: "GL", Code: "304"}, + "GM": {Name: "Gambia", ISOAlpha3: "GMB", ISOAlpha2: "GM", Code: "270"}, + "GN": {Name: "Guinea", ISOAlpha3: "GIN", ISOAlpha2: "GN", Code: "324"}, + "GP": {Name: "Guadeloupe", ISOAlpha3: "GLP", ISOAlpha2: "GP", Code: "312"}, + "GQ": {Name: "Equatorial Guinea", ISOAlpha3: "GNQ", ISOAlpha2: "GQ", Code: "226"}, + "GR": {Name: "Greece", ISOAlpha3: "GRC", ISOAlpha2: "GR", Code: "300"}, + "GS": {Name: "South Georgia and the South Sandwich Islands", ISOAlpha3: "SGS", ISOAlpha2: "GS", Code: "239"}, + "GT": {Name: "Guatemala", ISOAlpha3: "GTM", ISOAlpha2: "GT", Code: "320"}, + "GU": {Name: "Guam", ISOAlpha3: "GUM", ISOAlpha2: "GU", Code: "316"}, + "GW": {Name: "Guinea-Bissau", ISOAlpha3: "GNB", ISOAlpha2: "GW", Code: "624"}, + "GY": {Name: "Guyana", ISOAlpha3: "GUY", ISOAlpha2: "GY", Code: "328"}, + "HK": {Name: "Hong Kong", ISOAlpha3: "HKG", ISOAlpha2: "HK", Code: "344"}, + "HM": {Name: "Heard Island and McDonald Islands", ISOAlpha3: "HMD", ISOAlpha2: "HM", Code: "334"}, + "HN": {Name: "Honduras", ISOAlpha3: "HND", ISOAlpha2: "HN", Code: "340"}, + "HR": {Name: "Croatia", ISOAlpha3: "HRV", ISOAlpha2: "HR", Code: "191"}, + "HT": {Name: "Haiti", ISOAlpha3: "HTI", ISOAlpha2: "HT", Code: "332"}, + "HU": {Name: "Hungary", ISOAlpha3: "HUN", ISOAlpha2: "HU", Code: "348"}, + "ID": {Name: "Indonesia", ISOAlpha3: "IDN", ISOAlpha2: "ID", Code: "360"}, + "IE": {Name: "Ireland", ISOAlpha3: "IRL", ISOAlpha2: "IE", Code: "372"}, + "IL": {Name: "Israel", ISOAlpha3: "ISR", ISOAlpha2: "IL", Code: "376"}, + "IM": {Name: "Isle of Man", ISOAlpha3: "IMN", ISOAlpha2: "IM", Code: "833"}, + "IN": {Name: "India", ISOAlpha3: "IND", ISOAlpha2: "IN", Code: "356"}, + "IO": {Name: "British Indian Ocean Territory", ISOAlpha3: "IOT", ISOAlpha2: "IO", Code: "086"}, + "IQ": {Name: "Iraq", ISOAlpha3: "IRQ", ISOAlpha2: "IQ", Code: "368"}, + "IR": {Name: "Iran (Islamic Republic of)", ISOAlpha3: "IRN", ISOAlpha2: "IR", Code: "364"}, + "IS": {Name: "Iceland", ISOAlpha3: "ISL", ISOAlpha2: "IS", Code: "352"}, + "IT": {Name: "Italy", ISOAlpha3: "ITA", ISOAlpha2: "IT", Code: "380"}, + "JE": {Name: "Jersey", ISOAlpha3: "JEY", ISOAlpha2: "JE", Code: "832"}, + "JM": {Name: "Jamaica", ISOAlpha3: "JAM", ISOAlpha2: "JM", Code: "388"}, + "JO": {Name: "Jordan", ISOAlpha3: "JOR", ISOAlpha2: "JO", Code: "400"}, + "JP": {Name: "Japan", ISOAlpha3: "JPN", ISOAlpha2: "JP", Code: "392"}, + "KE": {Name: "Kenya", ISOAlpha3: "KEN", ISOAlpha2: "KE", Code: "404"}, + "KG": {Name: "Kyrgyzstan", ISOAlpha3: "KGZ", ISOAlpha2: "KG", Code: "417"}, + "KH": {Name: "Cambodia", ISOAlpha3: "KHM", ISOAlpha2: "KH", Code: "116"}, + "KI": {Name: "Kiribati", ISOAlpha3: "KIR", ISOAlpha2: "KI", Code: "296"}, + "KM": {Name: "Comoros", ISOAlpha3: "COM", ISOAlpha2: "KM", Code: "174"}, + "KN": {Name: "Saint Kitts and Nevis", ISOAlpha3: "KNA", ISOAlpha2: "KN", Code: "659"}, + "KP": {Name: "Korea (Democratic People's Republic of)", ISOAlpha3: "PRK", ISOAlpha2: "KP", Code: "408"}, + "KR": {Name: "Korea, Republic of", ISOAlpha3: "KOR", ISOAlpha2: "KR", Code: "410"}, + "KW": {Name: "Kuwait", ISOAlpha3: "KWT", ISOAlpha2: "KW", Code: "414"}, + "KY": {Name: "Cayman Islands", ISOAlpha3: "CYM", ISOAlpha2: "KY", Code: "136"}, + "KZ": {Name: "Kazakhstan", ISOAlpha3: "KAZ", ISOAlpha2: "KZ", Code: "398"}, + "LA": {Name: "Lao People's Democratic Republic", ISOAlpha3: "LAO", ISOAlpha2: "LA", Code: "418"}, + "LB": {Name: "Lebanon", ISOAlpha3: "LBN", ISOAlpha2: "LB", Code: "422"}, + "LC": {Name: "Saint Lucia", ISOAlpha3: "LCA", ISOAlpha2: "LC", Code: "662"}, + "LI": {Name: "Liechtenstein", ISOAlpha3: "LIE", ISOAlpha2: "LI", Code: "438"}, + "LK": {Name: "Sri Lanka", ISOAlpha3: "LKA", ISOAlpha2: "LK", Code: "144"}, + "LR": {Name: "Liberia", ISOAlpha3: "LBR", ISOAlpha2: "LR", Code: "430"}, + "LS": {Name: "Lesotho", ISOAlpha3: "LSO", ISOAlpha2: "LS", Code: "426"}, + "LT": {Name: "Lithuania", ISOAlpha3: "LTU", ISOAlpha2: "LT", Code: "440"}, + "LU": {Name: "Luxembourg", ISOAlpha3: "LUX", ISOAlpha2: "LU", Code: "442"}, + "LV": {Name: "Latvia", ISOAlpha3: "LVA", ISOAlpha2: "LV", Code: "428"}, + "LY": {Name: "Libya", ISOAlpha3: "LBY", ISOAlpha2: "LY", Code: "434"}, + "MA": {Name: "Morocco", ISOAlpha3: "MAR", ISOAlpha2: "MA", Code: "504"}, + "MC": {Name: "Monaco", ISOAlpha3: "MCO", ISOAlpha2: "MC", Code: "492"}, + "MD": {Name: "Moldova, Republic of", ISOAlpha3: "MDA", ISOAlpha2: "MD", Code: "498"}, + "ME": {Name: "Montenegro", ISOAlpha3: "MNE", ISOAlpha2: "ME", Code: "499"}, + "MF": {Name: "Saint Martin (French part)", ISOAlpha3: "MAF", ISOAlpha2: "MF", Code: "663"}, + "MG": {Name: "Madagascar", ISOAlpha3: "MDG", ISOAlpha2: "MG", Code: "450"}, + "MH": {Name: "Marshall Islands", ISOAlpha3: "MHL", ISOAlpha2: "MH", Code: "584"}, + "MK": {Name: "North Macedonia", ISOAlpha3: "MKD", ISOAlpha2: "MK", Code: "807"}, + "ML": {Name: "Mali", ISOAlpha3: "MLI", ISOAlpha2: "ML", Code: "466"}, + "MM": {Name: "Myanmar", ISOAlpha3: "MMR", ISOAlpha2: "MM", Code: "104"}, + "MN": {Name: "Mongolia", ISOAlpha3: "MNG", ISOAlpha2: "MN", Code: "496"}, + "MO": {Name: "Macao", ISOAlpha3: "MAC", ISOAlpha2: "MO", Code: "446"}, + "MP": {Name: "Northern Mariana Islands", ISOAlpha3: "MNP", ISOAlpha2: "MP", Code: "580"}, + "MQ": {Name: "Martinique", ISOAlpha3: "MTQ", ISOAlpha2: "MQ", Code: "474"}, + "MR": {Name: "Mauritania", ISOAlpha3: "MRT", ISOAlpha2: "MR", Code: "478"}, + "MS": {Name: "Montserrat", ISOAlpha3: "MSR", ISOAlpha2: "MS", Code: "500"}, + "MT": {Name: "Malta", ISOAlpha3: "MLT", ISOAlpha2: "MT", Code: "470"}, + "MU": {Name: "Mauritius", ISOAlpha3: "MUS", ISOAlpha2: "MU", Code: "480"}, + "MV": {Name: "Maldives", ISOAlpha3: "MDV", ISOAlpha2: "MV", Code: "462"}, + "MW": {Name: "Malawi", ISOAlpha3: "MWI", ISOAlpha2: "MW", Code: "454"}, + "MX": {Name: "Mexico", ISOAlpha3: "MEX", ISOAlpha2: "MX", Code: "484"}, + "MY": {Name: "Malaysia", ISOAlpha3: "MYS", ISOAlpha2: "MY", Code: "458"}, + "MZ": {Name: "Mozambique", ISOAlpha3: "MOZ", ISOAlpha2: "MZ", Code: "508"}, + "NA": {Name: "Namibia", ISOAlpha3: "NAM", ISOAlpha2: "NA", Code: "516"}, + "NC": {Name: "New Caledonia", ISOAlpha3: "NCL", ISOAlpha2: "NC", Code: "540"}, + "NE": {Name: "Niger", ISOAlpha3: "NER", ISOAlpha2: "NE", Code: "562"}, + "NF": {Name: "Norfolk Island", ISOAlpha3: "NFK", ISOAlpha2: "NF", Code: "574"}, + "NG": {Name: "Nigeria", ISOAlpha3: "NGA", ISOAlpha2: "NG", Code: "566"}, + "NI": {Name: "Nicaragua", ISOAlpha3: "NIC", ISOAlpha2: "NI", Code: "558"}, + "NL": {Name: "Netherlands", ISOAlpha3: "NLD", ISOAlpha2: "NL", Code: "528"}, + "NO": {Name: "Norway", ISOAlpha3: "NOR", ISOAlpha2: "NO", Code: "578"}, + "NP": {Name: "Nepal", ISOAlpha3: "NPL", ISOAlpha2: "NP", Code: "524"}, + "NR": {Name: "Nauru", ISOAlpha3: "NRU", ISOAlpha2: "NR", Code: "520"}, + "NU": {Name: "Niue", ISOAlpha3: "NIU", ISOAlpha2: "NU", Code: "570"}, + "NZ": {Name: "New Zealand", ISOAlpha3: "NZL", ISOAlpha2: "NZ", Code: "554"}, + "OM": {Name: "Oman", ISOAlpha3: "OMN", ISOAlpha2: "OM", Code: "512"}, + "PA": {Name: "Panama", ISOAlpha3: "PAN", ISOAlpha2: "PA", Code: "591"}, + "PE": {Name: "Peru", ISOAlpha3: "PER", ISOAlpha2: "PE", Code: "604"}, + "PF": {Name: "French Polynesia", ISOAlpha3: "PYF", ISOAlpha2: "PF", Code: "258"}, + "PG": {Name: "Papua New Guinea", ISOAlpha3: "PNG", ISOAlpha2: "PG", Code: "598"}, + "PH": {Name: "Philippines", ISOAlpha3: "PHL", ISOAlpha2: "PH", Code: "608"}, + "PK": {Name: "Pakistan", ISOAlpha3: "PAK", ISOAlpha2: "PK", Code: "586"}, + "PL": {Name: "Poland", ISOAlpha3: "POL", ISOAlpha2: "PL", Code: "616"}, + "PM": {Name: "Saint Pierre and Miquelon", ISOAlpha3: "SPM", ISOAlpha2: "PM", Code: "666"}, + "PN": {Name: "Pitcairn", ISOAlpha3: "PCN", ISOAlpha2: "PN", Code: "612"}, + "PR": {Name: "Puerto Rico", ISOAlpha3: "PRI", ISOAlpha2: "PR", Code: "630"}, + "PS": {Name: "Palestine, State of", ISOAlpha3: "PSE", ISOAlpha2: "PS", Code: "275"}, + "PT": {Name: "Portugal", ISOAlpha3: "PRT", ISOAlpha2: "PT", Code: "620"}, + "PW": {Name: "Palau", ISOAlpha3: "PLW", ISOAlpha2: "PW", Code: "585"}, + "PY": {Name: "Paraguay", ISOAlpha3: "PRY", ISOAlpha2: "PY", Code: "600"}, + "QA": {Name: "Qatar", ISOAlpha3: "QAT", ISOAlpha2: "QA", Code: "634"}, + "RE": {Name: "Réunion", ISOAlpha3: "REU", ISOAlpha2: "RE", Code: "638"}, + "RO": {Name: "Romania", ISOAlpha3: "ROU", ISOAlpha2: "RO", Code: "642"}, + "RS": {Name: "Serbia", ISOAlpha3: "SRB", ISOAlpha2: "RS", Code: "688"}, + "RU": {Name: "Russian Federation", ISOAlpha3: "RUS", ISOAlpha2: "RU", Code: "643"}, + "RW": {Name: "Rwanda", ISOAlpha3: "RWA", ISOAlpha2: "RW", Code: "646"}, + "SA": {Name: "Saudi Arabia", ISOAlpha3: "SAU", ISOAlpha2: "SA", Code: "682"}, + "SB": {Name: "Solomon Islands", ISOAlpha3: "SLB", ISOAlpha2: "SB", Code: "090"}, + "SC": {Name: "Seychelles", ISOAlpha3: "SYC", ISOAlpha2: "SC", Code: "690"}, + "SD": {Name: "Sudan", ISOAlpha3: "SDN", ISOAlpha2: "SD", Code: "729"}, + "SE": {Name: "Sweden", ISOAlpha3: "SWE", ISOAlpha2: "SE", Code: "752"}, + "SG": {Name: "Singapore", ISOAlpha3: "SGP", ISOAlpha2: "SG", Code: "702"}, + "SH": {Name: "Saint Helena, Ascension and Tristan da Cunha", ISOAlpha3: "SHN", ISOAlpha2: "SH", Code: "654"}, + "SI": {Name: "Slovenia", ISOAlpha3: "SVN", ISOAlpha2: "SI", Code: "705"}, + "SJ": {Name: "Svalbard and Jan Mayen", ISOAlpha3: "SJM", ISOAlpha2: "SJ", Code: "744"}, + "SK": {Name: "Slovakia", ISOAlpha3: "SVK", ISOAlpha2: "SK", Code: "703"}, + "SL": {Name: "Sierra Leone", ISOAlpha3: "SLE", ISOAlpha2: "SL", Code: "694"}, + "SM": {Name: "San Marino", ISOAlpha3: "SMR", ISOAlpha2: "SM", Code: "674"}, + "SN": {Name: "Senegal", ISOAlpha3: "SEN", ISOAlpha2: "SN", Code: "686"}, + "SO": {Name: "Somalia", ISOAlpha3: "SOM", ISOAlpha2: "SO", Code: "706"}, + "SR": {Name: "Suriname", ISOAlpha3: "SUR", ISOAlpha2: "SR", Code: "740"}, + "SS": {Name: "South Sudan", ISOAlpha3: "SSD", ISOAlpha2: "SS", Code: "728"}, + "ST": {Name: "Sao Tome and Principe", ISOAlpha3: "STP", ISOAlpha2: "ST", Code: "678"}, + "SV": {Name: "El Salvador", ISOAlpha3: "SLV", ISOAlpha2: "SV", Code: "222"}, + "SX": {Name: "Sint Maarten (Dutch part)", ISOAlpha3: "SXM", ISOAlpha2: "SX", Code: "534"}, + "SY": {Name: "Syrian Arab Republic", ISOAlpha3: "SYR", ISOAlpha2: "SY", Code: "760"}, + "SZ": {Name: "Eswatini", ISOAlpha3: "SWZ", ISOAlpha2: "SZ", Code: "748"}, + "TC": {Name: "Turks and Caicos Islands", ISOAlpha3: "TCA", ISOAlpha2: "TC", Code: "796"}, + "TD": {Name: "Chad", ISOAlpha3: "TCD", ISOAlpha2: "TD", Code: "148"}, + "TF": {Name: "French Southern Territories", ISOAlpha3: "ATF", ISOAlpha2: "TF", Code: "260"}, + "TG": {Name: "Togo", ISOAlpha3: "TGO", ISOAlpha2: "TG", Code: "768"}, + "TH": {Name: "Thailand", ISOAlpha3: "THA", ISOAlpha2: "TH", Code: "764"}, + "TJ": {Name: "Tajikistan", ISOAlpha3: "TJK", ISOAlpha2: "TJ", Code: "762"}, + "TK": {Name: "Tokelau", ISOAlpha3: "TKL", ISOAlpha2: "TK", Code: "772"}, + "TL": {Name: "Timor-Leste", ISOAlpha3: "TLS", ISOAlpha2: "TL", Code: "626"}, + "TM": {Name: "Turkmenistan", ISOAlpha3: "TKM", ISOAlpha2: "TM", Code: "795"}, + "TN": {Name: "Tunisia", ISOAlpha3: "TUN", ISOAlpha2: "TN", Code: "788"}, + "TO": {Name: "Tonga", ISOAlpha3: "TON", ISOAlpha2: "TO", Code: "776"}, + "TR": {Name: "Turkey", ISOAlpha3: "TUR", ISOAlpha2: "TR", Code: "792"}, + "TT": {Name: "Trinidad and Tobago", ISOAlpha3: "TTO", ISOAlpha2: "TT", Code: "780"}, + "TV": {Name: "Tuvalu", ISOAlpha3: "TUV", ISOAlpha2: "TV", Code: "798"}, + "TW": {Name: "Taiwan, Province of China", ISOAlpha3: "TWN", ISOAlpha2: "TW", Code: "158"}, + "TZ": {Name: "Tanzania, United Republic of", ISOAlpha3: "TZA", ISOAlpha2: "TZ", Code: "834"}, + "UA": {Name: "Ukraine", ISOAlpha3: "UKR", ISOAlpha2: "UA", Code: "804"}, + "UG": {Name: "Uganda", ISOAlpha3: "UGA", ISOAlpha2: "UG", Code: "800"}, + "UM": {Name: "United States Minor Outlying Islands", ISOAlpha3: "UMI", ISOAlpha2: "UM", Code: "581"}, + "US": {Name: "United States of America", ISOAlpha3: "USA", ISOAlpha2: "US", Code: "840"}, + "UY": {Name: "Uruguay", ISOAlpha3: "URY", ISOAlpha2: "UY", Code: "858"}, + "UZ": {Name: "Uzbekistan", ISOAlpha3: "UZB", ISOAlpha2: "UZ", Code: "860"}, + "VA": {Name: "Holy See", ISOAlpha3: "VAT", ISOAlpha2: "VA", Code: "336"}, + "VC": {Name: "Saint Vincent and the Grenadines", ISOAlpha3: "VCT", ISOAlpha2: "VC", Code: "670"}, + "VE": {Name: "Venezuela (Bolivarian Republic of)", ISOAlpha3: "VEN", ISOAlpha2: "VE", Code: "862"}, + "VG": {Name: "Virgin Islands (British)", ISOAlpha3: "VGB", ISOAlpha2: "VG", Code: "092"}, + "VI": {Name: "Virgin Islands (U.S.)", ISOAlpha3: "VIR", ISOAlpha2: "VI", Code: "850"}, + "VN": {Name: "Viet Nam", ISOAlpha3: "VNM", ISOAlpha2: "VN", Code: "704"}, + "VU": {Name: "Vanuatu", ISOAlpha3: "VUT", ISOAlpha2: "VU", Code: "548"}, + "WF": {Name: "Wallis and Futuna", ISOAlpha3: "WLF", ISOAlpha2: "WF", Code: "876"}, + "WS": {Name: "Samoa", ISOAlpha3: "WSM", ISOAlpha2: "WS", Code: "882"}, + "YE": {Name: "Yemen", ISOAlpha3: "YEM", ISOAlpha2: "YE", Code: "887"}, + "YT": {Name: "Mayotte", ISOAlpha3: "MYT", ISOAlpha2: "YT", Code: "175"}, + "ZA": {Name: "South Africa", ISOAlpha3: "ZAF", ISOAlpha2: "ZA", Code: "710"}, + "ZM": {Name: "Zambia", ISOAlpha3: "ZMB", ISOAlpha2: "ZM", Code: "894"}, + "ZW": {Name: "Zimbabwe", ISOAlpha3: "ZWE", ISOAlpha2: "ZW", Code: "716"}, +} diff --git a/vendor/github.com/go-openapi/strfmt/internal/countries/country.go b/vendor/github.com/go-openapi/strfmt/internal/countries/country.go new file mode 100644 index 0000000..7740514 --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/internal/countries/country.go @@ -0,0 +1,15 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +//go:generate go run gen.go -- countries.go +package countries + +// Country identifies a country with its english name, and ISO3166 codes. +// +//nolint:tagliatelle // JSON tags mirror the iso3166.json source keys (alpha-3, alpha-2, country-code); renaming them breaks the embedded-JSON unmarshal. +type Country struct { + Name string `json:"name"` + ISOAlpha3 string `json:"alpha-3"` + ISOAlpha2 string `json:"alpha-2"` + Code string `json:"country-code"` +} diff --git a/vendor/github.com/go-openapi/strfmt/internal/countries/iso3166.json b/vendor/github.com/go-openapi/strfmt/internal/countries/iso3166.json new file mode 100644 index 0000000..b2c0b5c --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/internal/countries/iso3166.json @@ -0,0 +1,251 @@ +[ +{"name":"Afghanistan","alpha-2":"AF","alpha-3":"AFG","country-code":"004","iso_3166-2":"ISO 3166-2:AF","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Åland Islands","alpha-2":"AX","alpha-3":"ALA","country-code":"248","iso_3166-2":"ISO 3166-2:AX","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Albania","alpha-2":"AL","alpha-3":"ALB","country-code":"008","iso_3166-2":"ISO 3166-2:AL","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Algeria","alpha-2":"DZ","alpha-3":"DZA","country-code":"012","iso_3166-2":"ISO 3166-2:DZ","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"American Samoa","alpha-2":"AS","alpha-3":"ASM","country-code":"016","iso_3166-2":"ISO 3166-2:AS","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Andorra","alpha-2":"AD","alpha-3":"AND","country-code":"020","iso_3166-2":"ISO 3166-2:AD","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Angola","alpha-2":"AO","alpha-3":"AGO","country-code":"024","iso_3166-2":"ISO 3166-2:AO","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Anguilla","alpha-2":"AI","alpha-3":"AIA","country-code":"660","iso_3166-2":"ISO 3166-2:AI","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Antarctica","alpha-2":"AQ","alpha-3":"ATA","country-code":"010","iso_3166-2":"ISO 3166-2:AQ","region":"","sub-region":"","intermediate-region":"","region-code":"","sub-region-code":"","intermediate-region-code":""}, +{"name":"Antigua and Barbuda","alpha-2":"AG","alpha-3":"ATG","country-code":"028","iso_3166-2":"ISO 3166-2:AG","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Argentina","alpha-2":"AR","alpha-3":"ARG","country-code":"032","iso_3166-2":"ISO 3166-2:AR","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Armenia","alpha-2":"AM","alpha-3":"ARM","country-code":"051","iso_3166-2":"ISO 3166-2:AM","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Aruba","alpha-2":"AW","alpha-3":"ABW","country-code":"533","iso_3166-2":"ISO 3166-2:AW","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Australia","alpha-2":"AU","alpha-3":"AUS","country-code":"036","iso_3166-2":"ISO 3166-2:AU","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"Austria","alpha-2":"AT","alpha-3":"AUT","country-code":"040","iso_3166-2":"ISO 3166-2:AT","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Azerbaijan","alpha-2":"AZ","alpha-3":"AZE","country-code":"031","iso_3166-2":"ISO 3166-2:AZ","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Bahamas","alpha-2":"BS","alpha-3":"BHS","country-code":"044","iso_3166-2":"ISO 3166-2:BS","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Bahrain","alpha-2":"BH","alpha-3":"BHR","country-code":"048","iso_3166-2":"ISO 3166-2:BH","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Bangladesh","alpha-2":"BD","alpha-3":"BGD","country-code":"050","iso_3166-2":"ISO 3166-2:BD","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Barbados","alpha-2":"BB","alpha-3":"BRB","country-code":"052","iso_3166-2":"ISO 3166-2:BB","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Belarus","alpha-2":"BY","alpha-3":"BLR","country-code":"112","iso_3166-2":"ISO 3166-2:BY","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Belgium","alpha-2":"BE","alpha-3":"BEL","country-code":"056","iso_3166-2":"ISO 3166-2:BE","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Belize","alpha-2":"BZ","alpha-3":"BLZ","country-code":"084","iso_3166-2":"ISO 3166-2:BZ","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Benin","alpha-2":"BJ","alpha-3":"BEN","country-code":"204","iso_3166-2":"ISO 3166-2:BJ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Bermuda","alpha-2":"BM","alpha-3":"BMU","country-code":"060","iso_3166-2":"ISO 3166-2:BM","region":"Americas","sub-region":"Northern America","intermediate-region":"","region-code":"019","sub-region-code":"021","intermediate-region-code":""}, +{"name":"Bhutan","alpha-2":"BT","alpha-3":"BTN","country-code":"064","iso_3166-2":"ISO 3166-2:BT","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Bolivia (Plurinational State of)","alpha-2":"BO","alpha-3":"BOL","country-code":"068","iso_3166-2":"ISO 3166-2:BO","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Bonaire, Sint Eustatius and Saba","alpha-2":"BQ","alpha-3":"BES","country-code":"535","iso_3166-2":"ISO 3166-2:BQ","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Bosnia and Herzegovina","alpha-2":"BA","alpha-3":"BIH","country-code":"070","iso_3166-2":"ISO 3166-2:BA","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Botswana","alpha-2":"BW","alpha-3":"BWA","country-code":"072","iso_3166-2":"ISO 3166-2:BW","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Southern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"018"}, +{"name":"Bouvet Island","alpha-2":"BV","alpha-3":"BVT","country-code":"074","iso_3166-2":"ISO 3166-2:BV","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Brazil","alpha-2":"BR","alpha-3":"BRA","country-code":"076","iso_3166-2":"ISO 3166-2:BR","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"British Indian Ocean Territory","alpha-2":"IO","alpha-3":"IOT","country-code":"086","iso_3166-2":"ISO 3166-2:IO","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Brunei Darussalam","alpha-2":"BN","alpha-3":"BRN","country-code":"096","iso_3166-2":"ISO 3166-2:BN","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Bulgaria","alpha-2":"BG","alpha-3":"BGR","country-code":"100","iso_3166-2":"ISO 3166-2:BG","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Burkina Faso","alpha-2":"BF","alpha-3":"BFA","country-code":"854","iso_3166-2":"ISO 3166-2:BF","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Burundi","alpha-2":"BI","alpha-3":"BDI","country-code":"108","iso_3166-2":"ISO 3166-2:BI","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Cabo Verde","alpha-2":"CV","alpha-3":"CPV","country-code":"132","iso_3166-2":"ISO 3166-2:CV","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Cambodia","alpha-2":"KH","alpha-3":"KHM","country-code":"116","iso_3166-2":"ISO 3166-2:KH","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Cameroon","alpha-2":"CM","alpha-3":"CMR","country-code":"120","iso_3166-2":"ISO 3166-2:CM","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Canada","alpha-2":"CA","alpha-3":"CAN","country-code":"124","iso_3166-2":"ISO 3166-2:CA","region":"Americas","sub-region":"Northern America","intermediate-region":"","region-code":"019","sub-region-code":"021","intermediate-region-code":""}, +{"name":"Cayman Islands","alpha-2":"KY","alpha-3":"CYM","country-code":"136","iso_3166-2":"ISO 3166-2:KY","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Central African Republic","alpha-2":"CF","alpha-3":"CAF","country-code":"140","iso_3166-2":"ISO 3166-2:CF","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Chad","alpha-2":"TD","alpha-3":"TCD","country-code":"148","iso_3166-2":"ISO 3166-2:TD","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Chile","alpha-2":"CL","alpha-3":"CHL","country-code":"152","iso_3166-2":"ISO 3166-2:CL","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"China","alpha-2":"CN","alpha-3":"CHN","country-code":"156","iso_3166-2":"ISO 3166-2:CN","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Christmas Island","alpha-2":"CX","alpha-3":"CXR","country-code":"162","iso_3166-2":"ISO 3166-2:CX","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"Cocos (Keeling) Islands","alpha-2":"CC","alpha-3":"CCK","country-code":"166","iso_3166-2":"ISO 3166-2:CC","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"Colombia","alpha-2":"CO","alpha-3":"COL","country-code":"170","iso_3166-2":"ISO 3166-2:CO","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Comoros","alpha-2":"KM","alpha-3":"COM","country-code":"174","iso_3166-2":"ISO 3166-2:KM","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Congo","alpha-2":"CG","alpha-3":"COG","country-code":"178","iso_3166-2":"ISO 3166-2:CG","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Congo, Democratic Republic of the","alpha-2":"CD","alpha-3":"COD","country-code":"180","iso_3166-2":"ISO 3166-2:CD","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Cook Islands","alpha-2":"CK","alpha-3":"COK","country-code":"184","iso_3166-2":"ISO 3166-2:CK","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Costa Rica","alpha-2":"CR","alpha-3":"CRI","country-code":"188","iso_3166-2":"ISO 3166-2:CR","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Côte d'Ivoire","alpha-2":"CI","alpha-3":"CIV","country-code":"384","iso_3166-2":"ISO 3166-2:CI","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Croatia","alpha-2":"HR","alpha-3":"HRV","country-code":"191","iso_3166-2":"ISO 3166-2:HR","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Cuba","alpha-2":"CU","alpha-3":"CUB","country-code":"192","iso_3166-2":"ISO 3166-2:CU","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Curaçao","alpha-2":"CW","alpha-3":"CUW","country-code":"531","iso_3166-2":"ISO 3166-2:CW","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Cyprus","alpha-2":"CY","alpha-3":"CYP","country-code":"196","iso_3166-2":"ISO 3166-2:CY","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Czechia","alpha-2":"CZ","alpha-3":"CZE","country-code":"203","iso_3166-2":"ISO 3166-2:CZ","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Denmark","alpha-2":"DK","alpha-3":"DNK","country-code":"208","iso_3166-2":"ISO 3166-2:DK","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Djibouti","alpha-2":"DJ","alpha-3":"DJI","country-code":"262","iso_3166-2":"ISO 3166-2:DJ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Dominica","alpha-2":"DM","alpha-3":"DMA","country-code":"212","iso_3166-2":"ISO 3166-2:DM","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Dominican Republic","alpha-2":"DO","alpha-3":"DOM","country-code":"214","iso_3166-2":"ISO 3166-2:DO","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Ecuador","alpha-2":"EC","alpha-3":"ECU","country-code":"218","iso_3166-2":"ISO 3166-2:EC","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Egypt","alpha-2":"EG","alpha-3":"EGY","country-code":"818","iso_3166-2":"ISO 3166-2:EG","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"El Salvador","alpha-2":"SV","alpha-3":"SLV","country-code":"222","iso_3166-2":"ISO 3166-2:SV","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Equatorial Guinea","alpha-2":"GQ","alpha-3":"GNQ","country-code":"226","iso_3166-2":"ISO 3166-2:GQ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Eritrea","alpha-2":"ER","alpha-3":"ERI","country-code":"232","iso_3166-2":"ISO 3166-2:ER","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Estonia","alpha-2":"EE","alpha-3":"EST","country-code":"233","iso_3166-2":"ISO 3166-2:EE","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Eswatini","alpha-2":"SZ","alpha-3":"SWZ","country-code":"748","iso_3166-2":"ISO 3166-2:SZ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Southern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"018"}, +{"name":"Ethiopia","alpha-2":"ET","alpha-3":"ETH","country-code":"231","iso_3166-2":"ISO 3166-2:ET","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Falkland Islands (Malvinas)","alpha-2":"FK","alpha-3":"FLK","country-code":"238","iso_3166-2":"ISO 3166-2:FK","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Faroe Islands","alpha-2":"FO","alpha-3":"FRO","country-code":"234","iso_3166-2":"ISO 3166-2:FO","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Fiji","alpha-2":"FJ","alpha-3":"FJI","country-code":"242","iso_3166-2":"ISO 3166-2:FJ","region":"Oceania","sub-region":"Melanesia","intermediate-region":"","region-code":"009","sub-region-code":"054","intermediate-region-code":""}, +{"name":"Finland","alpha-2":"FI","alpha-3":"FIN","country-code":"246","iso_3166-2":"ISO 3166-2:FI","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"France","alpha-2":"FR","alpha-3":"FRA","country-code":"250","iso_3166-2":"ISO 3166-2:FR","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"French Guiana","alpha-2":"GF","alpha-3":"GUF","country-code":"254","iso_3166-2":"ISO 3166-2:GF","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"French Polynesia","alpha-2":"PF","alpha-3":"PYF","country-code":"258","iso_3166-2":"ISO 3166-2:PF","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"French Southern Territories","alpha-2":"TF","alpha-3":"ATF","country-code":"260","iso_3166-2":"ISO 3166-2:TF","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Gabon","alpha-2":"GA","alpha-3":"GAB","country-code":"266","iso_3166-2":"ISO 3166-2:GA","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Gambia","alpha-2":"GM","alpha-3":"GMB","country-code":"270","iso_3166-2":"ISO 3166-2:GM","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Georgia","alpha-2":"GE","alpha-3":"GEO","country-code":"268","iso_3166-2":"ISO 3166-2:GE","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Germany","alpha-2":"DE","alpha-3":"DEU","country-code":"276","iso_3166-2":"ISO 3166-2:DE","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Ghana","alpha-2":"GH","alpha-3":"GHA","country-code":"288","iso_3166-2":"ISO 3166-2:GH","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Gibraltar","alpha-2":"GI","alpha-3":"GIB","country-code":"292","iso_3166-2":"ISO 3166-2:GI","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Greece","alpha-2":"GR","alpha-3":"GRC","country-code":"300","iso_3166-2":"ISO 3166-2:GR","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Greenland","alpha-2":"GL","alpha-3":"GRL","country-code":"304","iso_3166-2":"ISO 3166-2:GL","region":"Americas","sub-region":"Northern America","intermediate-region":"","region-code":"019","sub-region-code":"021","intermediate-region-code":""}, +{"name":"Grenada","alpha-2":"GD","alpha-3":"GRD","country-code":"308","iso_3166-2":"ISO 3166-2:GD","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Guadeloupe","alpha-2":"GP","alpha-3":"GLP","country-code":"312","iso_3166-2":"ISO 3166-2:GP","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Guam","alpha-2":"GU","alpha-3":"GUM","country-code":"316","iso_3166-2":"ISO 3166-2:GU","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Guatemala","alpha-2":"GT","alpha-3":"GTM","country-code":"320","iso_3166-2":"ISO 3166-2:GT","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Guernsey","alpha-2":"GG","alpha-3":"GGY","country-code":"831","iso_3166-2":"ISO 3166-2:GG","region":"Europe","sub-region":"Northern Europe","intermediate-region":"Channel Islands","region-code":"150","sub-region-code":"154","intermediate-region-code":"830"}, +{"name":"Guinea","alpha-2":"GN","alpha-3":"GIN","country-code":"324","iso_3166-2":"ISO 3166-2:GN","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Guinea-Bissau","alpha-2":"GW","alpha-3":"GNB","country-code":"624","iso_3166-2":"ISO 3166-2:GW","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Guyana","alpha-2":"GY","alpha-3":"GUY","country-code":"328","iso_3166-2":"ISO 3166-2:GY","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Haiti","alpha-2":"HT","alpha-3":"HTI","country-code":"332","iso_3166-2":"ISO 3166-2:HT","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Heard Island and McDonald Islands","alpha-2":"HM","alpha-3":"HMD","country-code":"334","iso_3166-2":"ISO 3166-2:HM","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"Holy See","alpha-2":"VA","alpha-3":"VAT","country-code":"336","iso_3166-2":"ISO 3166-2:VA","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Honduras","alpha-2":"HN","alpha-3":"HND","country-code":"340","iso_3166-2":"ISO 3166-2:HN","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Hong Kong","alpha-2":"HK","alpha-3":"HKG","country-code":"344","iso_3166-2":"ISO 3166-2:HK","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Hungary","alpha-2":"HU","alpha-3":"HUN","country-code":"348","iso_3166-2":"ISO 3166-2:HU","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Iceland","alpha-2":"IS","alpha-3":"ISL","country-code":"352","iso_3166-2":"ISO 3166-2:IS","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"India","alpha-2":"IN","alpha-3":"IND","country-code":"356","iso_3166-2":"ISO 3166-2:IN","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Indonesia","alpha-2":"ID","alpha-3":"IDN","country-code":"360","iso_3166-2":"ISO 3166-2:ID","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Iran (Islamic Republic of)","alpha-2":"IR","alpha-3":"IRN","country-code":"364","iso_3166-2":"ISO 3166-2:IR","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Iraq","alpha-2":"IQ","alpha-3":"IRQ","country-code":"368","iso_3166-2":"ISO 3166-2:IQ","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Ireland","alpha-2":"IE","alpha-3":"IRL","country-code":"372","iso_3166-2":"ISO 3166-2:IE","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Isle of Man","alpha-2":"IM","alpha-3":"IMN","country-code":"833","iso_3166-2":"ISO 3166-2:IM","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Israel","alpha-2":"IL","alpha-3":"ISR","country-code":"376","iso_3166-2":"ISO 3166-2:IL","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Italy","alpha-2":"IT","alpha-3":"ITA","country-code":"380","iso_3166-2":"ISO 3166-2:IT","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Jamaica","alpha-2":"JM","alpha-3":"JAM","country-code":"388","iso_3166-2":"ISO 3166-2:JM","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Japan","alpha-2":"JP","alpha-3":"JPN","country-code":"392","iso_3166-2":"ISO 3166-2:JP","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Jersey","alpha-2":"JE","alpha-3":"JEY","country-code":"832","iso_3166-2":"ISO 3166-2:JE","region":"Europe","sub-region":"Northern Europe","intermediate-region":"Channel Islands","region-code":"150","sub-region-code":"154","intermediate-region-code":"830"}, +{"name":"Jordan","alpha-2":"JO","alpha-3":"JOR","country-code":"400","iso_3166-2":"ISO 3166-2:JO","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Kazakhstan","alpha-2":"KZ","alpha-3":"KAZ","country-code":"398","iso_3166-2":"ISO 3166-2:KZ","region":"Asia","sub-region":"Central Asia","intermediate-region":"","region-code":"142","sub-region-code":"143","intermediate-region-code":""}, +{"name":"Kenya","alpha-2":"KE","alpha-3":"KEN","country-code":"404","iso_3166-2":"ISO 3166-2:KE","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Kiribati","alpha-2":"KI","alpha-3":"KIR","country-code":"296","iso_3166-2":"ISO 3166-2:KI","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Korea (Democratic People's Republic of)","alpha-2":"KP","alpha-3":"PRK","country-code":"408","iso_3166-2":"ISO 3166-2:KP","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Korea, Republic of","alpha-2":"KR","alpha-3":"KOR","country-code":"410","iso_3166-2":"ISO 3166-2:KR","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Kuwait","alpha-2":"KW","alpha-3":"KWT","country-code":"414","iso_3166-2":"ISO 3166-2:KW","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Kyrgyzstan","alpha-2":"KG","alpha-3":"KGZ","country-code":"417","iso_3166-2":"ISO 3166-2:KG","region":"Asia","sub-region":"Central Asia","intermediate-region":"","region-code":"142","sub-region-code":"143","intermediate-region-code":""}, +{"name":"Lao People's Democratic Republic","alpha-2":"LA","alpha-3":"LAO","country-code":"418","iso_3166-2":"ISO 3166-2:LA","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Latvia","alpha-2":"LV","alpha-3":"LVA","country-code":"428","iso_3166-2":"ISO 3166-2:LV","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Lebanon","alpha-2":"LB","alpha-3":"LBN","country-code":"422","iso_3166-2":"ISO 3166-2:LB","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Lesotho","alpha-2":"LS","alpha-3":"LSO","country-code":"426","iso_3166-2":"ISO 3166-2:LS","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Southern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"018"}, +{"name":"Liberia","alpha-2":"LR","alpha-3":"LBR","country-code":"430","iso_3166-2":"ISO 3166-2:LR","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Libya","alpha-2":"LY","alpha-3":"LBY","country-code":"434","iso_3166-2":"ISO 3166-2:LY","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"Liechtenstein","alpha-2":"LI","alpha-3":"LIE","country-code":"438","iso_3166-2":"ISO 3166-2:LI","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Lithuania","alpha-2":"LT","alpha-3":"LTU","country-code":"440","iso_3166-2":"ISO 3166-2:LT","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Luxembourg","alpha-2":"LU","alpha-3":"LUX","country-code":"442","iso_3166-2":"ISO 3166-2:LU","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Macao","alpha-2":"MO","alpha-3":"MAC","country-code":"446","iso_3166-2":"ISO 3166-2:MO","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Madagascar","alpha-2":"MG","alpha-3":"MDG","country-code":"450","iso_3166-2":"ISO 3166-2:MG","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Malawi","alpha-2":"MW","alpha-3":"MWI","country-code":"454","iso_3166-2":"ISO 3166-2:MW","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Malaysia","alpha-2":"MY","alpha-3":"MYS","country-code":"458","iso_3166-2":"ISO 3166-2:MY","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Maldives","alpha-2":"MV","alpha-3":"MDV","country-code":"462","iso_3166-2":"ISO 3166-2:MV","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Mali","alpha-2":"ML","alpha-3":"MLI","country-code":"466","iso_3166-2":"ISO 3166-2:ML","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Malta","alpha-2":"MT","alpha-3":"MLT","country-code":"470","iso_3166-2":"ISO 3166-2:MT","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Marshall Islands","alpha-2":"MH","alpha-3":"MHL","country-code":"584","iso_3166-2":"ISO 3166-2:MH","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Martinique","alpha-2":"MQ","alpha-3":"MTQ","country-code":"474","iso_3166-2":"ISO 3166-2:MQ","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Mauritania","alpha-2":"MR","alpha-3":"MRT","country-code":"478","iso_3166-2":"ISO 3166-2:MR","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Mauritius","alpha-2":"MU","alpha-3":"MUS","country-code":"480","iso_3166-2":"ISO 3166-2:MU","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Mayotte","alpha-2":"YT","alpha-3":"MYT","country-code":"175","iso_3166-2":"ISO 3166-2:YT","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Mexico","alpha-2":"MX","alpha-3":"MEX","country-code":"484","iso_3166-2":"ISO 3166-2:MX","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Micronesia (Federated States of)","alpha-2":"FM","alpha-3":"FSM","country-code":"583","iso_3166-2":"ISO 3166-2:FM","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Moldova, Republic of","alpha-2":"MD","alpha-3":"MDA","country-code":"498","iso_3166-2":"ISO 3166-2:MD","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Monaco","alpha-2":"MC","alpha-3":"MCO","country-code":"492","iso_3166-2":"ISO 3166-2:MC","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Mongolia","alpha-2":"MN","alpha-3":"MNG","country-code":"496","iso_3166-2":"ISO 3166-2:MN","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Montenegro","alpha-2":"ME","alpha-3":"MNE","country-code":"499","iso_3166-2":"ISO 3166-2:ME","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Montserrat","alpha-2":"MS","alpha-3":"MSR","country-code":"500","iso_3166-2":"ISO 3166-2:MS","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Morocco","alpha-2":"MA","alpha-3":"MAR","country-code":"504","iso_3166-2":"ISO 3166-2:MA","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"Mozambique","alpha-2":"MZ","alpha-3":"MOZ","country-code":"508","iso_3166-2":"ISO 3166-2:MZ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Myanmar","alpha-2":"MM","alpha-3":"MMR","country-code":"104","iso_3166-2":"ISO 3166-2:MM","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Namibia","alpha-2":"NA","alpha-3":"NAM","country-code":"516","iso_3166-2":"ISO 3166-2:NA","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Southern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"018"}, +{"name":"Nauru","alpha-2":"NR","alpha-3":"NRU","country-code":"520","iso_3166-2":"ISO 3166-2:NR","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Nepal","alpha-2":"NP","alpha-3":"NPL","country-code":"524","iso_3166-2":"ISO 3166-2:NP","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Netherlands","alpha-2":"NL","alpha-3":"NLD","country-code":"528","iso_3166-2":"ISO 3166-2:NL","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"New Caledonia","alpha-2":"NC","alpha-3":"NCL","country-code":"540","iso_3166-2":"ISO 3166-2:NC","region":"Oceania","sub-region":"Melanesia","intermediate-region":"","region-code":"009","sub-region-code":"054","intermediate-region-code":""}, +{"name":"New Zealand","alpha-2":"NZ","alpha-3":"NZL","country-code":"554","iso_3166-2":"ISO 3166-2:NZ","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"Nicaragua","alpha-2":"NI","alpha-3":"NIC","country-code":"558","iso_3166-2":"ISO 3166-2:NI","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Niger","alpha-2":"NE","alpha-3":"NER","country-code":"562","iso_3166-2":"ISO 3166-2:NE","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Nigeria","alpha-2":"NG","alpha-3":"NGA","country-code":"566","iso_3166-2":"ISO 3166-2:NG","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Niue","alpha-2":"NU","alpha-3":"NIU","country-code":"570","iso_3166-2":"ISO 3166-2:NU","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Norfolk Island","alpha-2":"NF","alpha-3":"NFK","country-code":"574","iso_3166-2":"ISO 3166-2:NF","region":"Oceania","sub-region":"Australia and New Zealand","intermediate-region":"","region-code":"009","sub-region-code":"053","intermediate-region-code":""}, +{"name":"North Macedonia","alpha-2":"MK","alpha-3":"MKD","country-code":"807","iso_3166-2":"ISO 3166-2:MK","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Northern Mariana Islands","alpha-2":"MP","alpha-3":"MNP","country-code":"580","iso_3166-2":"ISO 3166-2:MP","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Norway","alpha-2":"NO","alpha-3":"NOR","country-code":"578","iso_3166-2":"ISO 3166-2:NO","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Oman","alpha-2":"OM","alpha-3":"OMN","country-code":"512","iso_3166-2":"ISO 3166-2:OM","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Pakistan","alpha-2":"PK","alpha-3":"PAK","country-code":"586","iso_3166-2":"ISO 3166-2:PK","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Palau","alpha-2":"PW","alpha-3":"PLW","country-code":"585","iso_3166-2":"ISO 3166-2:PW","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Palestine, State of","alpha-2":"PS","alpha-3":"PSE","country-code":"275","iso_3166-2":"ISO 3166-2:PS","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Panama","alpha-2":"PA","alpha-3":"PAN","country-code":"591","iso_3166-2":"ISO 3166-2:PA","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Central America","region-code":"019","sub-region-code":"419","intermediate-region-code":"013"}, +{"name":"Papua New Guinea","alpha-2":"PG","alpha-3":"PNG","country-code":"598","iso_3166-2":"ISO 3166-2:PG","region":"Oceania","sub-region":"Melanesia","intermediate-region":"","region-code":"009","sub-region-code":"054","intermediate-region-code":""}, +{"name":"Paraguay","alpha-2":"PY","alpha-3":"PRY","country-code":"600","iso_3166-2":"ISO 3166-2:PY","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Peru","alpha-2":"PE","alpha-3":"PER","country-code":"604","iso_3166-2":"ISO 3166-2:PE","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Philippines","alpha-2":"PH","alpha-3":"PHL","country-code":"608","iso_3166-2":"ISO 3166-2:PH","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Pitcairn","alpha-2":"PN","alpha-3":"PCN","country-code":"612","iso_3166-2":"ISO 3166-2:PN","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Poland","alpha-2":"PL","alpha-3":"POL","country-code":"616","iso_3166-2":"ISO 3166-2:PL","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Portugal","alpha-2":"PT","alpha-3":"PRT","country-code":"620","iso_3166-2":"ISO 3166-2:PT","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Puerto Rico","alpha-2":"PR","alpha-3":"PRI","country-code":"630","iso_3166-2":"ISO 3166-2:PR","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Qatar","alpha-2":"QA","alpha-3":"QAT","country-code":"634","iso_3166-2":"ISO 3166-2:QA","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Réunion","alpha-2":"RE","alpha-3":"REU","country-code":"638","iso_3166-2":"ISO 3166-2:RE","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Romania","alpha-2":"RO","alpha-3":"ROU","country-code":"642","iso_3166-2":"ISO 3166-2:RO","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Russian Federation","alpha-2":"RU","alpha-3":"RUS","country-code":"643","iso_3166-2":"ISO 3166-2:RU","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Rwanda","alpha-2":"RW","alpha-3":"RWA","country-code":"646","iso_3166-2":"ISO 3166-2:RW","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Saint Barthélemy","alpha-2":"BL","alpha-3":"BLM","country-code":"652","iso_3166-2":"ISO 3166-2:BL","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Saint Helena, Ascension and Tristan da Cunha","alpha-2":"SH","alpha-3":"SHN","country-code":"654","iso_3166-2":"ISO 3166-2:SH","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Saint Kitts and Nevis","alpha-2":"KN","alpha-3":"KNA","country-code":"659","iso_3166-2":"ISO 3166-2:KN","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Saint Lucia","alpha-2":"LC","alpha-3":"LCA","country-code":"662","iso_3166-2":"ISO 3166-2:LC","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Saint Martin (French part)","alpha-2":"MF","alpha-3":"MAF","country-code":"663","iso_3166-2":"ISO 3166-2:MF","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Saint Pierre and Miquelon","alpha-2":"PM","alpha-3":"SPM","country-code":"666","iso_3166-2":"ISO 3166-2:PM","region":"Americas","sub-region":"Northern America","intermediate-region":"","region-code":"019","sub-region-code":"021","intermediate-region-code":""}, +{"name":"Saint Vincent and the Grenadines","alpha-2":"VC","alpha-3":"VCT","country-code":"670","iso_3166-2":"ISO 3166-2:VC","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Samoa","alpha-2":"WS","alpha-3":"WSM","country-code":"882","iso_3166-2":"ISO 3166-2:WS","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"San Marino","alpha-2":"SM","alpha-3":"SMR","country-code":"674","iso_3166-2":"ISO 3166-2:SM","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Sao Tome and Principe","alpha-2":"ST","alpha-3":"STP","country-code":"678","iso_3166-2":"ISO 3166-2:ST","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Middle Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"017"}, +{"name":"Saudi Arabia","alpha-2":"SA","alpha-3":"SAU","country-code":"682","iso_3166-2":"ISO 3166-2:SA","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Senegal","alpha-2":"SN","alpha-3":"SEN","country-code":"686","iso_3166-2":"ISO 3166-2:SN","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Serbia","alpha-2":"RS","alpha-3":"SRB","country-code":"688","iso_3166-2":"ISO 3166-2:RS","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Seychelles","alpha-2":"SC","alpha-3":"SYC","country-code":"690","iso_3166-2":"ISO 3166-2:SC","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Sierra Leone","alpha-2":"SL","alpha-3":"SLE","country-code":"694","iso_3166-2":"ISO 3166-2:SL","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Singapore","alpha-2":"SG","alpha-3":"SGP","country-code":"702","iso_3166-2":"ISO 3166-2:SG","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Sint Maarten (Dutch part)","alpha-2":"SX","alpha-3":"SXM","country-code":"534","iso_3166-2":"ISO 3166-2:SX","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Slovakia","alpha-2":"SK","alpha-3":"SVK","country-code":"703","iso_3166-2":"ISO 3166-2:SK","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"Slovenia","alpha-2":"SI","alpha-3":"SVN","country-code":"705","iso_3166-2":"ISO 3166-2:SI","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Solomon Islands","alpha-2":"SB","alpha-3":"SLB","country-code":"090","iso_3166-2":"ISO 3166-2:SB","region":"Oceania","sub-region":"Melanesia","intermediate-region":"","region-code":"009","sub-region-code":"054","intermediate-region-code":""}, +{"name":"Somalia","alpha-2":"SO","alpha-3":"SOM","country-code":"706","iso_3166-2":"ISO 3166-2:SO","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"South Africa","alpha-2":"ZA","alpha-3":"ZAF","country-code":"710","iso_3166-2":"ISO 3166-2:ZA","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Southern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"018"}, +{"name":"South Georgia and the South Sandwich Islands","alpha-2":"GS","alpha-3":"SGS","country-code":"239","iso_3166-2":"ISO 3166-2:GS","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"South Sudan","alpha-2":"SS","alpha-3":"SSD","country-code":"728","iso_3166-2":"ISO 3166-2:SS","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Spain","alpha-2":"ES","alpha-3":"ESP","country-code":"724","iso_3166-2":"ISO 3166-2:ES","region":"Europe","sub-region":"Southern Europe","intermediate-region":"","region-code":"150","sub-region-code":"039","intermediate-region-code":""}, +{"name":"Sri Lanka","alpha-2":"LK","alpha-3":"LKA","country-code":"144","iso_3166-2":"ISO 3166-2:LK","region":"Asia","sub-region":"Southern Asia","intermediate-region":"","region-code":"142","sub-region-code":"034","intermediate-region-code":""}, +{"name":"Sudan","alpha-2":"SD","alpha-3":"SDN","country-code":"729","iso_3166-2":"ISO 3166-2:SD","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"Suriname","alpha-2":"SR","alpha-3":"SUR","country-code":"740","iso_3166-2":"ISO 3166-2:SR","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Svalbard and Jan Mayen","alpha-2":"SJ","alpha-3":"SJM","country-code":"744","iso_3166-2":"ISO 3166-2:SJ","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Sweden","alpha-2":"SE","alpha-3":"SWE","country-code":"752","iso_3166-2":"ISO 3166-2:SE","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"Switzerland","alpha-2":"CH","alpha-3":"CHE","country-code":"756","iso_3166-2":"ISO 3166-2:CH","region":"Europe","sub-region":"Western Europe","intermediate-region":"","region-code":"150","sub-region-code":"155","intermediate-region-code":""}, +{"name":"Syrian Arab Republic","alpha-2":"SY","alpha-3":"SYR","country-code":"760","iso_3166-2":"ISO 3166-2:SY","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Taiwan, Province of China","alpha-2":"TW","alpha-3":"TWN","country-code":"158","iso_3166-2":"ISO 3166-2:TW","region":"Asia","sub-region":"Eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"030","intermediate-region-code":""}, +{"name":"Tajikistan","alpha-2":"TJ","alpha-3":"TJK","country-code":"762","iso_3166-2":"ISO 3166-2:TJ","region":"Asia","sub-region":"Central Asia","intermediate-region":"","region-code":"142","sub-region-code":"143","intermediate-region-code":""}, +{"name":"Tanzania, United Republic of","alpha-2":"TZ","alpha-3":"TZA","country-code":"834","iso_3166-2":"ISO 3166-2:TZ","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Thailand","alpha-2":"TH","alpha-3":"THA","country-code":"764","iso_3166-2":"ISO 3166-2:TH","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Timor-Leste","alpha-2":"TL","alpha-3":"TLS","country-code":"626","iso_3166-2":"ISO 3166-2:TL","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Togo","alpha-2":"TG","alpha-3":"TGO","country-code":"768","iso_3166-2":"ISO 3166-2:TG","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Western Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"011"}, +{"name":"Tokelau","alpha-2":"TK","alpha-3":"TKL","country-code":"772","iso_3166-2":"ISO 3166-2:TK","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Tonga","alpha-2":"TO","alpha-3":"TON","country-code":"776","iso_3166-2":"ISO 3166-2:TO","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Trinidad and Tobago","alpha-2":"TT","alpha-3":"TTO","country-code":"780","iso_3166-2":"ISO 3166-2:TT","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Tunisia","alpha-2":"TN","alpha-3":"TUN","country-code":"788","iso_3166-2":"ISO 3166-2:TN","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"Turkey","alpha-2":"TR","alpha-3":"TUR","country-code":"792","iso_3166-2":"ISO 3166-2:TR","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Turkmenistan","alpha-2":"TM","alpha-3":"TKM","country-code":"795","iso_3166-2":"ISO 3166-2:TM","region":"Asia","sub-region":"Central Asia","intermediate-region":"","region-code":"142","sub-region-code":"143","intermediate-region-code":""}, +{"name":"Turks and Caicos Islands","alpha-2":"TC","alpha-3":"TCA","country-code":"796","iso_3166-2":"ISO 3166-2:TC","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Tuvalu","alpha-2":"TV","alpha-3":"TUV","country-code":"798","iso_3166-2":"ISO 3166-2:TV","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Uganda","alpha-2":"UG","alpha-3":"UGA","country-code":"800","iso_3166-2":"ISO 3166-2:UG","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Ukraine","alpha-2":"UA","alpha-3":"UKR","country-code":"804","iso_3166-2":"ISO 3166-2:UA","region":"Europe","sub-region":"Eastern Europe","intermediate-region":"","region-code":"150","sub-region-code":"151","intermediate-region-code":""}, +{"name":"United Arab Emirates","alpha-2":"AE","alpha-3":"ARE","country-code":"784","iso_3166-2":"ISO 3166-2:AE","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"United Kingdom of Great Britain and Northern Ireland","alpha-2":"GB","alpha-3":"GBR","country-code":"826","iso_3166-2":"ISO 3166-2:GB","region":"Europe","sub-region":"Northern Europe","intermediate-region":"","region-code":"150","sub-region-code":"154","intermediate-region-code":""}, +{"name":"United States of America","alpha-2":"US","alpha-3":"USA","country-code":"840","iso_3166-2":"ISO 3166-2:US","region":"Americas","sub-region":"Northern America","intermediate-region":"","region-code":"019","sub-region-code":"021","intermediate-region-code":""}, +{"name":"United States Minor Outlying Islands","alpha-2":"UM","alpha-3":"UMI","country-code":"581","iso_3166-2":"ISO 3166-2:UM","region":"Oceania","sub-region":"Micronesia","intermediate-region":"","region-code":"009","sub-region-code":"057","intermediate-region-code":""}, +{"name":"Uruguay","alpha-2":"UY","alpha-3":"URY","country-code":"858","iso_3166-2":"ISO 3166-2:UY","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Uzbekistan","alpha-2":"UZ","alpha-3":"UZB","country-code":"860","iso_3166-2":"ISO 3166-2:UZ","region":"Asia","sub-region":"Central Asia","intermediate-region":"","region-code":"142","sub-region-code":"143","intermediate-region-code":""}, +{"name":"Vanuatu","alpha-2":"VU","alpha-3":"VUT","country-code":"548","iso_3166-2":"ISO 3166-2:VU","region":"Oceania","sub-region":"Melanesia","intermediate-region":"","region-code":"009","sub-region-code":"054","intermediate-region-code":""}, +{"name":"Venezuela (Bolivarian Republic of)","alpha-2":"VE","alpha-3":"VEN","country-code":"862","iso_3166-2":"ISO 3166-2:VE","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"South America","region-code":"019","sub-region-code":"419","intermediate-region-code":"005"}, +{"name":"Viet Nam","alpha-2":"VN","alpha-3":"VNM","country-code":"704","iso_3166-2":"ISO 3166-2:VN","region":"Asia","sub-region":"South-eastern Asia","intermediate-region":"","region-code":"142","sub-region-code":"035","intermediate-region-code":""}, +{"name":"Virgin Islands (British)","alpha-2":"VG","alpha-3":"VGB","country-code":"092","iso_3166-2":"ISO 3166-2:VG","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Virgin Islands (U.S.)","alpha-2":"VI","alpha-3":"VIR","country-code":"850","iso_3166-2":"ISO 3166-2:VI","region":"Americas","sub-region":"Latin America and the Caribbean","intermediate-region":"Caribbean","region-code":"019","sub-region-code":"419","intermediate-region-code":"029"}, +{"name":"Wallis and Futuna","alpha-2":"WF","alpha-3":"WLF","country-code":"876","iso_3166-2":"ISO 3166-2:WF","region":"Oceania","sub-region":"Polynesia","intermediate-region":"","region-code":"009","sub-region-code":"061","intermediate-region-code":""}, +{"name":"Western Sahara","alpha-2":"EH","alpha-3":"ESH","country-code":"732","iso_3166-2":"ISO 3166-2:EH","region":"Africa","sub-region":"Northern Africa","intermediate-region":"","region-code":"002","sub-region-code":"015","intermediate-region-code":""}, +{"name":"Yemen","alpha-2":"YE","alpha-3":"YEM","country-code":"887","iso_3166-2":"ISO 3166-2:YE","region":"Asia","sub-region":"Western Asia","intermediate-region":"","region-code":"142","sub-region-code":"145","intermediate-region-code":""}, +{"name":"Zambia","alpha-2":"ZM","alpha-3":"ZMB","country-code":"894","iso_3166-2":"ISO 3166-2:ZM","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"}, +{"name":"Zimbabwe","alpha-2":"ZW","alpha-3":"ZWE","country-code":"716","iso_3166-2":"ISO 3166-2:ZW","region":"Africa","sub-region":"Sub-Saharan Africa","intermediate-region":"Eastern Africa","region-code":"002","sub-region-code":"202","intermediate-region-code":"014"} +] diff --git a/vendor/github.com/go-openapi/strfmt/mongo.go b/vendor/github.com/go-openapi/strfmt/mongo.go index be904ff..15bfbed 100644 --- a/vendor/github.com/go-openapi/strfmt/mongo.go +++ b/vendor/github.com/go-openapi/strfmt/mongo.go @@ -4,7 +4,6 @@ package strfmt import ( - "encoding/base64" "encoding/binary" "fmt" "time" @@ -41,6 +40,8 @@ var ( _ bsonUnmarshaler = &Base64{} _ bsonMarshaler = Duration(0) _ bsonUnmarshaler = (*Duration)(nil) + _ bsonMarshaler = DurationISO8601(0) + _ bsonUnmarshaler = (*DurationISO8601)(nil) _ bsonMarshaler = DateTime{} _ bsonUnmarshaler = &DateTime{} _ bsonMarshaler = ULID{} @@ -92,6 +93,10 @@ var ( _ bsonValueUnmarshaler = &DateTime{} _ bsonValueMarshaler = ObjectId{} _ bsonValueUnmarshaler = &ObjectId{} + _ bsonMarshaler = Currency{} + _ bsonUnmarshaler = (*Currency)(nil) + _ bsonMarshaler = Country{} + _ bsonUnmarshaler = (*Country)(nil) ) const ( @@ -140,7 +145,7 @@ func (b *Base64) UnmarshalBSON(data []byte) error { return fmt.Errorf("couldn't unmarshal bson bytes as base64: %w", ErrFormat) } - vb, err := base64.StdEncoding.DecodeString(s) + vb, err := base64Encoding.DecodeString(s) if err != nil { return err } @@ -171,6 +176,38 @@ func (d *Duration) UnmarshalBSON(data []byte) error { return nil } +// MarshalBSON renders the [ISODuration] as a BSON document. +// +// BSON is a storage boundary (like SQL): the value is emitted losslessly with [ISODuration.String], regardless of the +// policy P — a strict policy that could not serialize a sign or sub-second precision on the interchange path must still +// be persistable. +func (d ISODuration[P]) MarshalBSON() ([]byte, error) { + return bsonlite.C.MarshalDoc(d.String()) +} + +// UnmarshalBSON reads an [ISODuration] from a BSON document. +// +// The stored value is our own canonical output, so it is parsed leniently: BSON is trusted storage, not external +// interchange, and must round-trip whatever [ISODuration.MarshalBSON] emitted even under a strict policy P. +func (d *ISODuration[P]) UnmarshalBSON(data []byte) error { + v, err := bsonlite.C.UnmarshalDoc(data) + if err != nil { + return err + } + + s, ok := v.(string) + if !ok { + return fmt.Errorf("couldn't unmarshal bson bytes value as ISODuration: %w", ErrFormat) + } + + rd, err := parseISO8601Duration(s, DurationLenient{}.isoDurationConfig()) + if err != nil { + return err + } + *d = ISODuration[P](rd) + return nil +} + // MarshalBSON renders the [DateTime] as a BSON document. func (t DateTime) MarshalBSON() ([]byte, error) { tNorm := NormalizeTimeForMarshal(time.Time(t)) @@ -599,3 +636,47 @@ func (id *ObjectId) UnmarshalBSONValue(_ byte, data []byte) error { *id = ObjectId(oid) return nil } + +// MarshalBSON document from this value. +func (u Currency) MarshalBSON() ([]byte, error) { + return bsonlite.C.MarshalDoc(u.String()) +} + +// UnmarshalBSON document into this value. +func (u *Currency) UnmarshalBSON(data []byte) error { + s, err := unmarshalBSONString(data, "Currency") + if err != nil { + return err + } + + cur, err := ParseCurrency(s) + if err != nil { + return err + } + + *u = cur + + return nil +} + +// MarshalBSON document from this value. +func (u Country) MarshalBSON() ([]byte, error) { + return bsonlite.C.MarshalDoc(u.String()) +} + +// UnmarshalBSON document into this value. +func (u *Country) UnmarshalBSON(data []byte) error { + s, err := unmarshalBSONString(data, "Country") + if err != nil { + return err + } + + cur, err := ParseCountry(s) + if err != nil { + return err + } + + *u = cur + + return nil +} diff --git a/vendor/github.com/go-openapi/strfmt/register.go b/vendor/github.com/go-openapi/strfmt/register.go new file mode 100644 index 0000000..4a4c185 --- /dev/null +++ b/vendor/github.com/go-openapi/strfmt/register.go @@ -0,0 +1,138 @@ +// SPDX-FileCopyrightText: Copyright 2015-2025 go-swagger maintainers +// SPDX-License-Identifier: Apache-2.0 + +package strfmt + +// Default is the default formats registry. +// +// NOTE: format "duration" is wire by default onto "duration-human". +var Default Registry //nolint:gochecknoglobals // package-level default registry, by design + +// JSONSchema2020Registry is the format registry with JSONSchema draft 2020 formats (e.g. duration is an iso8601 duration). +var JSONSchema2020Registry Registry //nolint:gochecknoglobals // package-level default registry, by design + +func init() { //nolint:gochecknoinits // registers all default string formats in the registry + // register formats in the default registry: + // - byte + // - creditcard + // - email + // - hexcolor + // - hostname + // - ipv4 + // - ipv6 + // - cidr + // - isbn + // - isbn10 + // - isbn13 + // - mac + // - password + // - rgbcolor + // - ssn + // - uri + // - uuid + // - uuid3 + // - uuid4 + // - uuid5 + // - uuid7 + // - ulid + // - date, date-time + // - duration, duration-human, duration-iso8601 + // - objectid + // - currency, country + Default = NewSeededFormats(nil, nil) + + u := URI("") + Default.Add("uri", &u, isRequestURI) + + eml := Email("") + Default.Add("email", &eml, IsEmail) + + hn := Hostname("") + Default.Add("hostname", &hn, IsHostname) + + ip4 := IPv4("") + Default.Add("ipv4", &ip4, isIPv4) + + ip6 := IPv6("") + Default.Add("ipv6", &ip6, isIPv6) + + cidr := CIDR("") + Default.Add("cidr", &cidr, isCIDR) + + mac := MAC("") + Default.Add("mac", &mac, isMAC) + + uid := UUID("") + Default.Add("uuid", &uid, IsUUID) + + uid3 := UUID3("") + Default.Add("uuid3", &uid3, IsUUID3) + + uid4 := UUID4("") + Default.Add("uuid4", &uid4, IsUUID4) + + uid5 := UUID5("") + Default.Add("uuid5", &uid5, IsUUID5) + + uid7 := UUID7("") + Default.Add("uuid7", &uid7, IsUUID7) + + isbn := ISBN("") + Default.Add("isbn", &isbn, func(str string) bool { return isISBN10(str) || isISBN13(str) }) + + isbn10 := ISBN10("") + Default.Add("isbn10", &isbn10, isISBN10) + + isbn13 := ISBN13("") + Default.Add("isbn13", &isbn13, isISBN13) + + cc := CreditCard("") + Default.Add("creditcard", &cc, isCreditCard) + + ssn := SSN("") + Default.Add("ssn", &ssn, isSSN) + + hc := HexColor("") + Default.Add("hexcolor", &hc, isHexcolor) + + rc := RGBColor("") + Default.Add("rgbcolor", &rc, isRGBcolor) + + b64 := Base64([]byte(nil)) + Default.Add("byte", &b64, isBase64) + + pw := Password("") + Default.Add("password", &pw, func(_ string) bool { return true }) + + d := Date{} + Default.Add("date", &d, IsDate) + + dt := DateTime{} + Default.Add("datetime", &dt, IsDateTime) + + du := Duration(0) + Default.Add("duration", &du, IsDuration) + Default.Add("duration-human", &du, IsDuration) + + di := DurationISO8601(0) + Default.Add("duration-iso8601", &di, IsDurationISO8601) + + var id ObjectId + Default.Add("bsonobjectid", &id, IsBSONObjectID) + + ulid := ULID{} + Default.Add("ulid", &ulid, IsULID) + + cur := Currency{} + Default.Add("currency", &cur, IsCurrency) + + co := Country{} + Default.Add("country", &co, IsCountry) + + def, ok := Default.(*defaultFormats) + if !ok { + panic("internal error: can't initialize") + } + + JSONSchema2020Registry = NewSeededFormats(def.data, JSONSchema2020Normalizer) +} diff --git a/vendor/github.com/go-openapi/strfmt/time.go b/vendor/github.com/go-openapi/strfmt/time.go index 1fde8c6..94e409e 100644 --- a/vendor/github.com/go-openapi/strfmt/time.go +++ b/vendor/github.com/go-openapi/strfmt/time.go @@ -17,11 +17,6 @@ import ( // Unix 0 for an EST timezone is not equivalent to a UTC timezone. var UnixZero = time.Unix(0, 0).UTC() //nolint:gochecknoglobals // package-level sentinel value for unix epoch -func init() { //nolint:gochecknoinits // registers datetime format in the default registry - dt := DateTime{} - Default.Add("datetime", &dt, IsDateTime) -} - // IsDateTime returns true when the string is a valid date-time. // // JSON datetime format consist of a date and a time separated by a "T", e.g. 2012-04-23T18:25:43.511Z. diff --git a/vendor/github.com/go-openapi/strfmt/ulid.go b/vendor/github.com/go-openapi/strfmt/ulid.go index f05d22c..38809ad 100644 --- a/vendor/github.com/go-openapi/strfmt/ulid.go +++ b/vendor/github.com/go-openapi/strfmt/ulid.go @@ -69,11 +69,6 @@ var ( ULIDValueOverrideFunc = ULIDValueDefaultFunc ) -func init() { //nolint:gochecknoinits // registers ulid format in the default registry - ulid := ULID{} - Default.Add("ulid", &ulid, IsULID) -} - // IsULID checks if provided string is [ULID] format // Be noticed that this function considers overflowed [ULID] as non-[ulid]. // For more details see https://github.com/[ulid]/spec diff --git a/vendor/golang.org/x/net/idna/idna.go b/vendor/golang.org/x/net/idna/idna.go index 2276712..e2f28fe 100644 --- a/vendor/golang.org/x/net/idna/idna.go +++ b/vendor/golang.org/x/net/idna/idna.go @@ -400,7 +400,11 @@ func (p *Profile) process(s string, toASCII bool) (string, error) { // Spec says keep the old label. continue } - if unicode16 && err == nil && len(u) > 0 && isASCII(u) { + if err == nil && len(u) > 0 && isASCII(u) { + // UTS 43 pre-revision 33 doesn't classify a xn-- label + // which contains only ASCII characters as an error, + // but that's a specification bug and a security issue. + // Always return an error in this case. err = punyError(enc) } isBidi = isBidi || bidirule.DirectionString(u) != bidi.LeftToRight diff --git a/vendor/golang.org/x/text/currency/common.go b/vendor/golang.org/x/text/currency/common.go new file mode 100644 index 0000000..fef15be --- /dev/null +++ b/vendor/golang.org/x/text/currency/common.go @@ -0,0 +1,67 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package currency + +import ( + "time" + + "golang.org/x/text/language" +) + +// This file contains code common to gen.go and the package code. + +const ( + cashShift = 3 + roundMask = 0x7 + + nonTenderBit = 0x8000 +) + +// currencyInfo contains information about a currency. +// bits 0..2: index into roundings for standard rounding +// bits 3..5: index into roundings for cash rounding +type currencyInfo byte + +// roundingType defines the scale (number of fractional decimals) and increments +// in terms of units of size 10^-scale. For example, for scale == 2 and +// increment == 1, the currency is rounded to units of 0.01. +type roundingType struct { + scale, increment uint8 +} + +// roundings contains rounding data for currencies. This struct is +// created by hand as it is very unlikely to change much. +var roundings = [...]roundingType{ + {2, 1}, // default + {0, 1}, + {1, 1}, + {3, 1}, + {4, 1}, + {2, 5}, // cash rounding alternative + {2, 50}, +} + +// regionToCode returns a 16-bit region code. Only two-letter codes are +// supported. (Three-letter codes are not needed.) +func regionToCode(r language.Region) uint16 { + if s := r.String(); len(s) == 2 { + return uint16(s[0])<<8 | uint16(s[1]) + } + return 0 +} + +func toDate(t time.Time) uint32 { + y := t.Year() + if y == 1 { + return 0 + } + date := uint32(y) << 4 + date |= uint32(t.Month()) + date <<= 5 + date |= uint32(t.Day()) + return date +} + +func fromDate(date uint32) time.Time { + return time.Date(int(date>>9), time.Month((date>>5)&0xf), int(date&0x1f), 0, 0, 0, 0, time.UTC) +} diff --git a/vendor/golang.org/x/text/currency/currency.go b/vendor/golang.org/x/text/currency/currency.go new file mode 100644 index 0000000..598ddef --- /dev/null +++ b/vendor/golang.org/x/text/currency/currency.go @@ -0,0 +1,185 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +// Package currency contains currency-related functionality. +// +// NOTE: the formatting functionality is currently under development and may +// change without notice. +package currency // import "golang.org/x/text/currency" + +import ( + "errors" + "sort" + + "golang.org/x/text/internal/tag" + "golang.org/x/text/language" +) + +// TODO: +// - language-specific currency names. +// - currency formatting. +// - currency information per region +// - register currency code (there are no private use area) + +// TODO: remove Currency type from package language. + +// Kind determines the rounding and rendering properties of a currency value. +type Kind struct { + rounding rounding + // TODO: formatting type: standard, accounting. See CLDR. +} + +type rounding byte + +const ( + standard rounding = iota + cash +) + +var ( + // Standard defines standard rounding and formatting for currencies. + Standard Kind = Kind{rounding: standard} + + // Cash defines rounding and formatting standards for cash transactions. + Cash Kind = Kind{rounding: cash} + + // Accounting defines rounding and formatting standards for accounting. + Accounting Kind = Kind{rounding: standard} +) + +// Rounding reports the rounding characteristics for the given currency, where +// scale is the number of fractional decimals and increment is the number of +// units in terms of 10^(-scale) to which to round to. +func (k Kind) Rounding(cur Unit) (scale, increment int) { + info := currency.Elem(int(cur.index))[3] + switch k.rounding { + case standard: + info &= roundMask + case cash: + info >>= cashShift + } + return int(roundings[info].scale), int(roundings[info].increment) +} + +// Unit is an ISO 4217 currency designator. +type Unit struct { + index uint16 +} + +// String returns the ISO code of u. +func (u Unit) String() string { + if u.index == 0 { + return "XXX" + } + return currency.Elem(int(u.index))[:3] +} + +// Amount creates an Amount for the given currency unit and amount. +func (u Unit) Amount(amount interface{}) Amount { + // TODO: verify amount is a supported number type + return Amount{amount: amount, currency: u} +} + +var ( + errSyntax = errors.New("currency: tag is not well-formed") + errValue = errors.New("currency: tag is not a recognized currency") +) + +// ParseISO parses a 3-letter ISO 4217 currency code. It returns an error if s +// is not well-formed or not a recognized currency code. +func ParseISO(s string) (Unit, error) { + var buf [4]byte // Take one byte more to detect oversize keys. + key := buf[:copy(buf[:], s)] + if !tag.FixCase("XXX", key) { + return Unit{}, errSyntax + } + if i := currency.Index(key); i >= 0 { + if i == xxx { + return Unit{}, nil + } + return Unit{uint16(i)}, nil + } + return Unit{}, errValue +} + +// MustParseISO is like ParseISO, but panics if the given currency unit +// cannot be parsed. It simplifies safe initialization of Unit values. +func MustParseISO(s string) Unit { + c, err := ParseISO(s) + if err != nil { + panic(err) + } + return c +} + +// FromRegion reports the currency unit that is currently legal tender in the +// given region according to CLDR. It will return false if region currently does +// not have a legal tender. +func FromRegion(r language.Region) (currency Unit, ok bool) { + x := regionToCode(r) + i := sort.Search(len(regionToCurrency), func(i int) bool { + return regionToCurrency[i].region >= x + }) + if i < len(regionToCurrency) && regionToCurrency[i].region == x { + return Unit{regionToCurrency[i].code}, true + } + return Unit{}, false +} + +// FromTag reports the most likely currency for the given tag. It considers the +// currency defined in the -u extension and infers the region if necessary. +func FromTag(t language.Tag) (Unit, language.Confidence) { + if cur := t.TypeForKey("cu"); len(cur) == 3 { + c, _ := ParseISO(cur) + return c, language.Exact + } + r, conf := t.Region() + if cur, ok := FromRegion(r); ok { + return cur, conf + } + return Unit{}, language.No +} + +var ( + // Undefined and testing. + XXX Unit = Unit{} + XTS Unit = Unit{xts} + + // G10 currencies https://en.wikipedia.org/wiki/G10_currencies. + USD Unit = Unit{usd} + EUR Unit = Unit{eur} + JPY Unit = Unit{jpy} + GBP Unit = Unit{gbp} + CHF Unit = Unit{chf} + AUD Unit = Unit{aud} + NZD Unit = Unit{nzd} + CAD Unit = Unit{cad} + SEK Unit = Unit{sek} + NOK Unit = Unit{nok} + + // Additional common currencies as defined by CLDR. + BRL Unit = Unit{brl} + CNY Unit = Unit{cny} + DKK Unit = Unit{dkk} + INR Unit = Unit{inr} + RUB Unit = Unit{rub} + HKD Unit = Unit{hkd} + IDR Unit = Unit{idr} + KRW Unit = Unit{krw} + MXN Unit = Unit{mxn} + PLN Unit = Unit{pln} + SAR Unit = Unit{sar} + THB Unit = Unit{thb} + TRY Unit = Unit{try} + TWD Unit = Unit{twd} + ZAR Unit = Unit{zar} + + // Precious metals. + XAG Unit = Unit{xag} + XAU Unit = Unit{xau} + XPT Unit = Unit{xpt} + XPD Unit = Unit{xpd} +) diff --git a/vendor/golang.org/x/text/currency/format.go b/vendor/golang.org/x/text/currency/format.go new file mode 100644 index 0000000..cc4570d --- /dev/null +++ b/vendor/golang.org/x/text/currency/format.go @@ -0,0 +1,220 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package currency + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/format" + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/internal/number" + + "golang.org/x/text/language" +) + +// Amount is an amount-currency unit pair. +type Amount struct { + amount interface{} // Change to decimal(64|128). + currency Unit +} + +// Currency reports the currency unit of this amount. +func (a Amount) Currency() Unit { return a.currency } + +// TODO: based on decimal type, but may make sense to customize a bit. +// func (a Amount) Decimal() +// func (a Amount) Int() (int64, error) +// func (a Amount) Fraction() (int64, error) +// func (a Amount) Rat() *big.Rat +// func (a Amount) Float() (float64, error) +// func (a Amount) Scale() uint +// func (a Amount) Precision() uint +// func (a Amount) Sign() int +// +// Add/Sub/Div/Mul/Round. + +// Format implements fmt.Formatter. It accepts format.State for +// language-specific rendering. +func (a Amount) Format(s fmt.State, verb rune) { + v := formattedValue{ + currency: a.currency, + amount: a.amount, + format: defaultFormat, + } + v.Format(s, verb) +} + +// formattedValue is currency amount or unit that implements language-sensitive +// formatting. +type formattedValue struct { + currency Unit + amount interface{} // Amount, Unit, or number. + format *options +} + +// Format implements fmt.Formatter. It accepts format.State for +// language-specific rendering. +func (v formattedValue) Format(s fmt.State, verb rune) { + var tag language.Tag + var lang compact.ID + if state, ok := s.(format.State); ok { + tag = state.Language() + lang, _ = compact.RegionalID(compact.Tag(tag)) + } + + // Get the options. Use DefaultFormat if not present. + opt := v.format + if opt == nil { + opt = defaultFormat + } + cur := v.currency + if cur.index == 0 { + cur = opt.currency + } + + sym := opt.symbol(lang, cur) + if v.amount != nil { + var f number.Formatter + f.InitDecimal(tag) + + scale, increment := opt.kind.Rounding(cur) + f.RoundingContext.SetScale(scale) + f.RoundingContext.Increment = uint32(increment) + f.RoundingContext.IncrementScale = uint8(scale) + f.RoundingContext.Mode = number.ToNearestAway + + d := f.Append(nil, v.amount) + + fmt.Fprint(s, sym, " ", string(d)) + } else { + fmt.Fprint(s, sym) + } +} + +// Formatter decorates a given number, Unit or Amount with formatting options. +type Formatter func(amount interface{}) formattedValue + +// func (f Formatter) Options(opts ...Option) Formatter + +// TODO: call this a Formatter or FormatFunc? + +var dummy = USD.Amount(0) + +// adjust creates a new Formatter based on the adjustments of fn on f. +func (f Formatter) adjust(fn func(*options)) Formatter { + var o options = *(f(dummy).format) + fn(&o) + return o.format +} + +// Default creates a new Formatter that defaults to currency unit c if a numeric +// value is passed that is not associated with a currency. +func (f Formatter) Default(currency Unit) Formatter { + return f.adjust(func(o *options) { o.currency = currency }) +} + +// Kind sets the kind of the underlying currency unit. +func (f Formatter) Kind(k Kind) Formatter { + return f.adjust(func(o *options) { o.kind = k }) +} + +var defaultFormat *options = ISO(dummy).format + +var ( + // Uses Narrow symbols. Overrides Symbol, if present. + NarrowSymbol Formatter = Formatter(formNarrow) + + // Use Symbols instead of ISO codes, when available. + Symbol Formatter = Formatter(formSymbol) + + // Use ISO code as symbol. + ISO Formatter = Formatter(formISO) + + // TODO: + // // Use full name as symbol. + // Name Formatter +) + +// options configures rendering and rounding options for an Amount. +type options struct { + currency Unit + kind Kind + + symbol func(compactIndex compact.ID, c Unit) string +} + +func (o *options) format(amount interface{}) formattedValue { + v := formattedValue{format: o} + switch x := amount.(type) { + case Amount: + v.amount = x.amount + v.currency = x.currency + case *Amount: + v.amount = x.amount + v.currency = x.currency + case Unit: + v.currency = x + case *Unit: + v.currency = *x + default: + if o.currency.index == 0 { + panic("cannot format number without a currency being set") + } + // TODO: Must be a number. + v.amount = x + v.currency = o.currency + } + return v +} + +var ( + optISO = options{symbol: lookupISO} + optSymbol = options{symbol: lookupSymbol} + optNarrow = options{symbol: lookupNarrow} +) + +// These need to be functions, rather than curried methods, as curried methods +// are evaluated at init time, causing tables to be included unconditionally. +func formISO(x interface{}) formattedValue { return optISO.format(x) } +func formSymbol(x interface{}) formattedValue { return optSymbol.format(x) } +func formNarrow(x interface{}) formattedValue { return optNarrow.format(x) } + +func lookupISO(x compact.ID, c Unit) string { return c.String() } +func lookupSymbol(x compact.ID, c Unit) string { return normalSymbol.lookup(x, c) } +func lookupNarrow(x compact.ID, c Unit) string { return narrowSymbol.lookup(x, c) } + +type symbolIndex struct { + index []uint16 // position corresponds with compact index of language. + data []curToIndex +} + +var ( + normalSymbol = symbolIndex{normalLangIndex, normalSymIndex} + narrowSymbol = symbolIndex{narrowLangIndex, narrowSymIndex} +) + +func (x *symbolIndex) lookup(lang compact.ID, c Unit) string { + for { + index := x.data[x.index[lang]:x.index[lang+1]] + i := sort.Search(len(index), func(i int) bool { + return index[i].cur >= c.index + }) + if i < len(index) && index[i].cur == c.index { + x := index[i].idx + start := x + 1 + end := start + uint16(symbols[x]) + if start == end { + return c.String() + } + return symbols[start:end] + } + if lang == 0 { + break + } + lang = lang.Parent() + } + return c.String() +} diff --git a/vendor/golang.org/x/text/currency/query.go b/vendor/golang.org/x/text/currency/query.go new file mode 100644 index 0000000..7bf9430 --- /dev/null +++ b/vendor/golang.org/x/text/currency/query.go @@ -0,0 +1,152 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package currency + +import ( + "sort" + "time" + + "golang.org/x/text/language" +) + +// QueryIter represents a set of Units. The default set includes all Units that +// are currently in use as legal tender in any Region. +type QueryIter interface { + // Next returns true if there is a next element available. + // It must be called before any of the other methods are called. + Next() bool + + // Unit returns the unit of the current iteration. + Unit() Unit + + // Region returns the Region for the current iteration. + Region() language.Region + + // From returns the date from which the unit was used in the region. + // It returns false if this date is unknown. + From() (time.Time, bool) + + // To returns the date up till which the unit was used in the region. + // It returns false if this date is unknown or if the unit is still in use. + To() (time.Time, bool) + + // IsTender reports whether the unit is a legal tender in the region during + // the specified date range. + IsTender() bool +} + +// Query represents a set of Units. The default set includes all Units that are +// currently in use as legal tender in any Region. +func Query(options ...QueryOption) QueryIter { + it := &iter{ + end: len(regionData), + date: 0xFFFFFFFF, + } + for _, fn := range options { + fn(it) + } + return it +} + +// NonTender returns a new query that also includes matching Units that are not +// legal tender. +var NonTender QueryOption = nonTender + +func nonTender(i *iter) { + i.nonTender = true +} + +// Historical selects the units for all dates. +var Historical QueryOption = historical + +func historical(i *iter) { + i.date = hist +} + +// A QueryOption can be used to change the set of unit information returned by +// a query. +type QueryOption func(*iter) + +// Date queries the units that were in use at the given point in history. +func Date(t time.Time) QueryOption { + d := toDate(t) + return func(i *iter) { + i.date = d + } +} + +// Region limits the query to only return entries for the given region. +func Region(r language.Region) QueryOption { + p, end := len(regionData), len(regionData) + x := regionToCode(r) + i := sort.Search(len(regionData), func(i int) bool { + return regionData[i].region >= x + }) + if i < len(regionData) && regionData[i].region == x { + p = i + for i++; i < len(regionData) && regionData[i].region == x; i++ { + } + end = i + } + return func(i *iter) { + i.p, i.end = p, end + } +} + +const ( + hist = 0x00 + now = 0xFFFFFFFF +) + +type iter struct { + *regionInfo + p, end int + date uint32 + nonTender bool +} + +func (i *iter) Next() bool { + for ; i.p < i.end; i.p++ { + i.regionInfo = ®ionData[i.p] + if !i.nonTender && !i.IsTender() { + continue + } + if i.date == hist || (i.from <= i.date && (i.to == 0 || i.date <= i.to)) { + i.p++ + return true + } + } + return false +} + +func (r *regionInfo) Region() language.Region { + // TODO: this could be much faster. + var buf [2]byte + buf[0] = uint8(r.region >> 8) + buf[1] = uint8(r.region) + return language.MustParseRegion(string(buf[:])) +} + +func (r *regionInfo) Unit() Unit { + return Unit{r.code &^ nonTenderBit} +} + +func (r *regionInfo) IsTender() bool { + return r.code&nonTenderBit == 0 +} + +func (r *regionInfo) From() (time.Time, bool) { + if r.from == 0 { + return time.Time{}, false + } + return fromDate(r.from), true +} + +func (r *regionInfo) To() (time.Time, bool) { + if r.to == 0 { + return time.Time{}, false + } + return fromDate(r.to), true +} diff --git a/vendor/golang.org/x/text/currency/tables.go b/vendor/golang.org/x/text/currency/tables.go new file mode 100644 index 0000000..d1a7440 --- /dev/null +++ b/vendor/golang.org/x/text/currency/tables.go @@ -0,0 +1,2629 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package currency + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + xxx = 285 + xts = 283 + usd = 252 + eur = 94 + jpy = 133 + gbp = 99 + chf = 61 + aud = 19 + nzd = 192 + cad = 58 + sek = 219 + nok = 190 + dkk = 82 + xag = 266 + xau = 267 + xpt = 280 + xpd = 278 + brl = 46 + cny = 68 + inr = 125 + rub = 210 + hkd = 114 + idr = 120 + krw = 141 + mxn = 178 + pln = 201 + sar = 213 + thb = 235 + try = 244 + twd = 246 + zar = 293 +) + +// currency holds an alphabetically sorted list of canonical 3-letter currency +// identifiers. Each identifier is followed by a byte of type currencyInfo, +// defined in gen_common.go. +const currency tag.Index = "" + // Size: 1208 bytes + "\x00\x00\x00\x00ADP\x09AED\x00AFA\x00AFN\x09ALK\x00ALL\x09AMD\x09ANG\x00" + + "AOA\x00AOK\x00AON\x00AOR\x00ARA\x00ARL\x00ARM\x00ARP\x00ARS\x00ATS\x00AU" + + "D\x00AWG\x00AZM\x00AZN\x00BAD\x00BAM\x00BAN\x00BBD\x00BDT\x00BEC\x00BEF" + + "\x00BEL\x00BGL\x00BGM\x00BGN\x00BGO\x00BHD\x1bBIF\x09BMD\x00BND\x00BOB" + + "\x00BOL\x00BOP\x00BOV\x00BRB\x00BRC\x00BRE\x00BRL\x00BRN\x00BRR\x00BRZ" + + "\x00BSD\x00BTN\x00BUK\x00BWP\x00BYB\x00BYN\x00BYR\x09BZD\x00CAD(CDF\x00C" + + "HE\x00CHF(CHW\x00CLE\x00CLF$CLP\x09CNH\x00CNX\x00CNY\x00COP\x09COU\x00CR" + + "C\x08CSD\x00CSK\x00CUC\x00CUP\x00CVE\x00CYP\x00CZK\x08DDM\x00DEM\x00DJF" + + "\x09DKK0DOP\x00DZD\x00ECS\x00ECV\x00EEK\x00EGP\x00ERN\x00ESA\x00ESB\x00E" + + "SP\x09ETB\x00EUR\x00FIM\x00FJD\x00FKP\x00FRF\x00GBP\x00GEK\x00GEL\x00GHC" + + "\x00GHS\x00GIP\x00GMD\x00GNF\x09GNS\x00GQE\x00GRD\x00GTQ\x00GWE\x00GWP" + + "\x00GYD\x09HKD\x00HNL\x00HRD\x00HRK\x00HTG\x00HUF\x08IDR\x09IEP\x00ILP" + + "\x00ILR\x00ILS\x00INR\x00IQD\x09IRR\x09ISJ\x00ISK\x09ITL\x09JMD\x00JOD" + + "\x1bJPY\x09KES\x00KGS\x00KHR\x00KMF\x09KPW\x09KRH\x00KRO\x00KRW\x09KWD" + + "\x1bKYD\x00KZT\x00LAK\x09LBP\x09LKR\x00LRD\x00LSL\x00LTL\x00LTT\x00LUC" + + "\x00LUF\x09LUL\x00LVL\x00LVR\x00LYD\x1bMAD\x00MAF\x00MCF\x00MDC\x00MDL" + + "\x00MGA\x09MGF\x09MKD\x00MKN\x00MLF\x00MMK\x09MNT\x09MOP\x00MRO\x09MTL" + + "\x00MTP\x00MUR\x09MVP\x00MVR\x00MWK\x00MXN\x00MXP\x00MXV\x00MYR\x00MZE" + + "\x00MZM\x00MZN\x00NAD\x00NGN\x00NIC\x00NIO\x00NLG\x00NOK\x08NPR\x00NZD" + + "\x00OMR\x1bPAB\x00PEI\x00PEN\x00PES\x00PGK\x00PHP\x00PKR\x09PLN\x00PLZ" + + "\x00PTE\x00PYG\x09QAR\x00RHD\x00ROL\x00RON\x00RSD\x09RUB\x00RUR\x00RWF" + + "\x09SAR\x00SBD\x00SCR\x00SDD\x00SDG\x00SDP\x00SEK\x08SGD\x00SHP\x00SIT" + + "\x00SKK\x00SLL\x09SOS\x09SRD\x00SRG\x00SSP\x00STD\x09STN\x00SUR\x00SVC" + + "\x00SYP\x09SZL\x00THB\x00TJR\x00TJS\x00TMM\x09TMT\x00TND\x1bTOP\x00TPE" + + "\x00TRL\x09TRY\x00TTD\x00TWD\x08TZS\x09UAH\x00UAK\x00UGS\x00UGX\x09USD" + + "\x00USN\x00USS\x00UYI\x09UYP\x00UYU\x00UZS\x09VEB\x00VEF\x00VND\x09VNN" + + "\x00VUV\x09WST\x00XAF\x09XAG\x00XAU\x00XBA\x00XBB\x00XBC\x00XBD\x00XCD" + + "\x00XDR\x00XEU\x00XFO\x00XFU\x00XOF\x09XPD\x00XPF\x09XPT\x00XRE\x00XSU" + + "\x00XTS\x00XUA\x00XXX\x00YDD\x00YER\x09YUD\x00YUM\x00YUN\x00YUR\x00ZAL" + + "\x00ZAR\x00ZMK\x09ZMW\x00ZRN\x00ZRZ\x00ZWD\x09ZWL\x00ZWR\x00\xff\xff\xff" + + "\xff" + +const numCurrencies = 300 + +type toCurrency struct { + region uint16 + code uint16 +} + +var regionToCurrency = []toCurrency{ // 255 elements + 0: {region: 0x4143, code: 0xdd}, + 1: {region: 0x4144, code: 0x5e}, + 2: {region: 0x4145, code: 0x2}, + 3: {region: 0x4146, code: 0x4}, + 4: {region: 0x4147, code: 0x110}, + 5: {region: 0x4149, code: 0x110}, + 6: {region: 0x414c, code: 0x6}, + 7: {region: 0x414d, code: 0x7}, + 8: {region: 0x414f, code: 0x9}, + 9: {region: 0x4152, code: 0x11}, + 10: {region: 0x4153, code: 0xfc}, + 11: {region: 0x4154, code: 0x5e}, + 12: {region: 0x4155, code: 0x13}, + 13: {region: 0x4157, code: 0x14}, + 14: {region: 0x4158, code: 0x5e}, + 15: {region: 0x415a, code: 0x16}, + 16: {region: 0x4241, code: 0x18}, + 17: {region: 0x4242, code: 0x1a}, + 18: {region: 0x4244, code: 0x1b}, + 19: {region: 0x4245, code: 0x5e}, + 20: {region: 0x4246, code: 0x115}, + 21: {region: 0x4247, code: 0x21}, + 22: {region: 0x4248, code: 0x23}, + 23: {region: 0x4249, code: 0x24}, + 24: {region: 0x424a, code: 0x115}, + 25: {region: 0x424c, code: 0x5e}, + 26: {region: 0x424d, code: 0x25}, + 27: {region: 0x424e, code: 0x26}, + 28: {region: 0x424f, code: 0x27}, + 29: {region: 0x4251, code: 0xfc}, + 30: {region: 0x4252, code: 0x2e}, + 31: {region: 0x4253, code: 0x32}, + 32: {region: 0x4254, code: 0x33}, + 33: {region: 0x4256, code: 0xbe}, + 34: {region: 0x4257, code: 0x35}, + 35: {region: 0x4259, code: 0x37}, + 36: {region: 0x425a, code: 0x39}, + 37: {region: 0x4341, code: 0x3a}, + 38: {region: 0x4343, code: 0x13}, + 39: {region: 0x4344, code: 0x3b}, + 40: {region: 0x4346, code: 0x109}, + 41: {region: 0x4347, code: 0x109}, + 42: {region: 0x4348, code: 0x3d}, + 43: {region: 0x4349, code: 0x115}, + 44: {region: 0x434b, code: 0xc0}, + 45: {region: 0x434c, code: 0x41}, + 46: {region: 0x434d, code: 0x109}, + 47: {region: 0x434e, code: 0x44}, + 48: {region: 0x434f, code: 0x45}, + 49: {region: 0x4352, code: 0x47}, + 50: {region: 0x4355, code: 0x4b}, + 51: {region: 0x4356, code: 0x4c}, + 52: {region: 0x4357, code: 0x8}, + 53: {region: 0x4358, code: 0x13}, + 54: {region: 0x4359, code: 0x5e}, + 55: {region: 0x435a, code: 0x4e}, + 56: {region: 0x4445, code: 0x5e}, + 57: {region: 0x4447, code: 0xfc}, + 58: {region: 0x444a, code: 0x51}, + 59: {region: 0x444b, code: 0x52}, + 60: {region: 0x444d, code: 0x110}, + 61: {region: 0x444f, code: 0x53}, + 62: {region: 0x445a, code: 0x54}, + 63: {region: 0x4541, code: 0x5e}, + 64: {region: 0x4543, code: 0xfc}, + 65: {region: 0x4545, code: 0x5e}, + 66: {region: 0x4547, code: 0x58}, + 67: {region: 0x4548, code: 0x9e}, + 68: {region: 0x4552, code: 0x59}, + 69: {region: 0x4553, code: 0x5e}, + 70: {region: 0x4554, code: 0x5d}, + 71: {region: 0x4555, code: 0x5e}, + 72: {region: 0x4649, code: 0x5e}, + 73: {region: 0x464a, code: 0x60}, + 74: {region: 0x464b, code: 0x61}, + 75: {region: 0x464d, code: 0xfc}, + 76: {region: 0x464f, code: 0x52}, + 77: {region: 0x4652, code: 0x5e}, + 78: {region: 0x4741, code: 0x109}, + 79: {region: 0x4742, code: 0x63}, + 80: {region: 0x4744, code: 0x110}, + 81: {region: 0x4745, code: 0x65}, + 82: {region: 0x4746, code: 0x5e}, + 83: {region: 0x4747, code: 0x63}, + 84: {region: 0x4748, code: 0x67}, + 85: {region: 0x4749, code: 0x68}, + 86: {region: 0x474c, code: 0x52}, + 87: {region: 0x474d, code: 0x69}, + 88: {region: 0x474e, code: 0x6a}, + 89: {region: 0x4750, code: 0x5e}, + 90: {region: 0x4751, code: 0x109}, + 91: {region: 0x4752, code: 0x5e}, + 92: {region: 0x4753, code: 0x63}, + 93: {region: 0x4754, code: 0x6e}, + 94: {region: 0x4755, code: 0xfc}, + 95: {region: 0x4757, code: 0x115}, + 96: {region: 0x4759, code: 0x71}, + 97: {region: 0x484b, code: 0x72}, + 98: {region: 0x484d, code: 0x13}, + 99: {region: 0x484e, code: 0x73}, + 100: {region: 0x4852, code: 0x75}, + 101: {region: 0x4854, code: 0x76}, + 102: {region: 0x4855, code: 0x77}, + 103: {region: 0x4943, code: 0x5e}, + 104: {region: 0x4944, code: 0x78}, + 105: {region: 0x4945, code: 0x5e}, + 106: {region: 0x494c, code: 0x7c}, + 107: {region: 0x494d, code: 0x63}, + 108: {region: 0x494e, code: 0x7d}, + 109: {region: 0x494f, code: 0xfc}, + 110: {region: 0x4951, code: 0x7e}, + 111: {region: 0x4952, code: 0x7f}, + 112: {region: 0x4953, code: 0x81}, + 113: {region: 0x4954, code: 0x5e}, + 114: {region: 0x4a45, code: 0x63}, + 115: {region: 0x4a4d, code: 0x83}, + 116: {region: 0x4a4f, code: 0x84}, + 117: {region: 0x4a50, code: 0x85}, + 118: {region: 0x4b45, code: 0x86}, + 119: {region: 0x4b47, code: 0x87}, + 120: {region: 0x4b48, code: 0x88}, + 121: {region: 0x4b49, code: 0x13}, + 122: {region: 0x4b4d, code: 0x89}, + 123: {region: 0x4b4e, code: 0x110}, + 124: {region: 0x4b50, code: 0x8a}, + 125: {region: 0x4b52, code: 0x8d}, + 126: {region: 0x4b57, code: 0x8e}, + 127: {region: 0x4b59, code: 0x8f}, + 128: {region: 0x4b5a, code: 0x90}, + 129: {region: 0x4c41, code: 0x91}, + 130: {region: 0x4c42, code: 0x92}, + 131: {region: 0x4c43, code: 0x110}, + 132: {region: 0x4c49, code: 0x3d}, + 133: {region: 0x4c4b, code: 0x93}, + 134: {region: 0x4c52, code: 0x94}, + 135: {region: 0x4c53, code: 0x125}, + 136: {region: 0x4c54, code: 0x5e}, + 137: {region: 0x4c55, code: 0x5e}, + 138: {region: 0x4c56, code: 0x5e}, + 139: {region: 0x4c59, code: 0x9d}, + 140: {region: 0x4d41, code: 0x9e}, + 141: {region: 0x4d43, code: 0x5e}, + 142: {region: 0x4d44, code: 0xa2}, + 143: {region: 0x4d45, code: 0x5e}, + 144: {region: 0x4d46, code: 0x5e}, + 145: {region: 0x4d47, code: 0xa3}, + 146: {region: 0x4d48, code: 0xfc}, + 147: {region: 0x4d4b, code: 0xa5}, + 148: {region: 0x4d4c, code: 0x115}, + 149: {region: 0x4d4d, code: 0xa8}, + 150: {region: 0x4d4e, code: 0xa9}, + 151: {region: 0x4d4f, code: 0xaa}, + 152: {region: 0x4d50, code: 0xfc}, + 153: {region: 0x4d51, code: 0x5e}, + 154: {region: 0x4d52, code: 0xab}, + 155: {region: 0x4d53, code: 0x110}, + 156: {region: 0x4d54, code: 0x5e}, + 157: {region: 0x4d55, code: 0xae}, + 158: {region: 0x4d56, code: 0xb0}, + 159: {region: 0x4d57, code: 0xb1}, + 160: {region: 0x4d58, code: 0xb2}, + 161: {region: 0x4d59, code: 0xb5}, + 162: {region: 0x4d5a, code: 0xb8}, + 163: {region: 0x4e41, code: 0xb9}, + 164: {region: 0x4e43, code: 0x117}, + 165: {region: 0x4e45, code: 0x115}, + 166: {region: 0x4e46, code: 0x13}, + 167: {region: 0x4e47, code: 0xba}, + 168: {region: 0x4e49, code: 0xbc}, + 169: {region: 0x4e4c, code: 0x5e}, + 170: {region: 0x4e4f, code: 0xbe}, + 171: {region: 0x4e50, code: 0xbf}, + 172: {region: 0x4e52, code: 0x13}, + 173: {region: 0x4e55, code: 0xc0}, + 174: {region: 0x4e5a, code: 0xc0}, + 175: {region: 0x4f4d, code: 0xc1}, + 176: {region: 0x5041, code: 0xc2}, + 177: {region: 0x5045, code: 0xc4}, + 178: {region: 0x5046, code: 0x117}, + 179: {region: 0x5047, code: 0xc6}, + 180: {region: 0x5048, code: 0xc7}, + 181: {region: 0x504b, code: 0xc8}, + 182: {region: 0x504c, code: 0xc9}, + 183: {region: 0x504d, code: 0x5e}, + 184: {region: 0x504e, code: 0xc0}, + 185: {region: 0x5052, code: 0xfc}, + 186: {region: 0x5053, code: 0x7c}, + 187: {region: 0x5054, code: 0x5e}, + 188: {region: 0x5057, code: 0xfc}, + 189: {region: 0x5059, code: 0xcc}, + 190: {region: 0x5141, code: 0xcd}, + 191: {region: 0x5245, code: 0x5e}, + 192: {region: 0x524f, code: 0xd0}, + 193: {region: 0x5253, code: 0xd1}, + 194: {region: 0x5255, code: 0xd2}, + 195: {region: 0x5257, code: 0xd4}, + 196: {region: 0x5341, code: 0xd5}, + 197: {region: 0x5342, code: 0xd6}, + 198: {region: 0x5343, code: 0xd7}, + 199: {region: 0x5344, code: 0xd9}, + 200: {region: 0x5345, code: 0xdb}, + 201: {region: 0x5347, code: 0xdc}, + 202: {region: 0x5348, code: 0xdd}, + 203: {region: 0x5349, code: 0x5e}, + 204: {region: 0x534a, code: 0xbe}, + 205: {region: 0x534b, code: 0x5e}, + 206: {region: 0x534c, code: 0xe0}, + 207: {region: 0x534d, code: 0x5e}, + 208: {region: 0x534e, code: 0x115}, + 209: {region: 0x534f, code: 0xe1}, + 210: {region: 0x5352, code: 0xe2}, + 211: {region: 0x5353, code: 0xe4}, + 212: {region: 0x5354, code: 0xe6}, + 213: {region: 0x5356, code: 0xfc}, + 214: {region: 0x5358, code: 0x8}, + 215: {region: 0x5359, code: 0xe9}, + 216: {region: 0x535a, code: 0xea}, + 217: {region: 0x5441, code: 0x63}, + 218: {region: 0x5443, code: 0xfc}, + 219: {region: 0x5444, code: 0x109}, + 220: {region: 0x5446, code: 0x5e}, + 221: {region: 0x5447, code: 0x115}, + 222: {region: 0x5448, code: 0xeb}, + 223: {region: 0x544a, code: 0xed}, + 224: {region: 0x544b, code: 0xc0}, + 225: {region: 0x544c, code: 0xfc}, + 226: {region: 0x544d, code: 0xef}, + 227: {region: 0x544e, code: 0xf0}, + 228: {region: 0x544f, code: 0xf1}, + 229: {region: 0x5452, code: 0xf4}, + 230: {region: 0x5454, code: 0xf5}, + 231: {region: 0x5456, code: 0x13}, + 232: {region: 0x5457, code: 0xf6}, + 233: {region: 0x545a, code: 0xf7}, + 234: {region: 0x5541, code: 0xf8}, + 235: {region: 0x5547, code: 0xfb}, + 236: {region: 0x554d, code: 0xfc}, + 237: {region: 0x5553, code: 0xfc}, + 238: {region: 0x5559, code: 0x101}, + 239: {region: 0x555a, code: 0x102}, + 240: {region: 0x5641, code: 0x5e}, + 241: {region: 0x5643, code: 0x110}, + 242: {region: 0x5645, code: 0x104}, + 243: {region: 0x5647, code: 0xfc}, + 244: {region: 0x5649, code: 0xfc}, + 245: {region: 0x564e, code: 0x105}, + 246: {region: 0x5655, code: 0x107}, + 247: {region: 0x5746, code: 0x117}, + 248: {region: 0x5753, code: 0x108}, + 249: {region: 0x584b, code: 0x5e}, + 250: {region: 0x5945, code: 0x11f}, + 251: {region: 0x5954, code: 0x5e}, + 252: {region: 0x5a41, code: 0x125}, + 253: {region: 0x5a4d, code: 0x127}, + 254: {region: 0x5a57, code: 0xfc}, +} // Size: 1044 bytes + +type regionInfo struct { + region uint16 + code uint16 + from uint32 + to uint32 +} + +var regionData = []regionInfo{ // 495 elements + 0: {region: 0x4143, code: 0xdd, from: 0xf7021, to: 0x0}, + 1: {region: 0x4144, code: 0x5e, from: 0xf9e21, to: 0x0}, + 2: {region: 0x4144, code: 0x5c, from: 0xea221, to: 0xfa45c}, + 3: {region: 0x4144, code: 0x62, from: 0xf5021, to: 0xfa451}, + 4: {region: 0x4144, code: 0x1, from: 0xf2021, to: 0xfa39f}, + 5: {region: 0x4145, code: 0x2, from: 0xf6ab3, to: 0x0}, + 6: {region: 0x4146, code: 0x4, from: 0xfa547, to: 0x0}, + 7: {region: 0x4146, code: 0x3, from: 0xf0e6e, to: 0xfa59f}, + 8: {region: 0x4147, code: 0x110, from: 0xf5b46, to: 0x0}, + 9: {region: 0x4149, code: 0x110, from: 0xf5b46, to: 0x0}, + 10: {region: 0x414c, code: 0x6, from: 0xf5b10, to: 0x0}, + 11: {region: 0x414c, code: 0x5, from: 0xf3561, to: 0xf5b10}, + 12: {region: 0x414d, code: 0x7, from: 0xf9376, to: 0x0}, + 13: {region: 0x414d, code: 0xd3, from: 0xf8f99, to: 0xf9376}, + 14: {region: 0x414d, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 15: {region: 0x414f, code: 0x9, from: 0xf9f8d, to: 0x0}, + 16: {region: 0x414f, code: 0xc, from: 0xf96e1, to: 0xfa041}, + 17: {region: 0x414f, code: 0xb, from: 0xf8d39, to: 0xfa041}, + 18: {region: 0x414f, code: 0xa, from: 0xf7228, to: 0xf8e61}, + 19: {region: 0x4151, code: 0x811d, from: 0x0, to: 0x0}, + 20: {region: 0x4152, code: 0x11, from: 0xf9021, to: 0x0}, + 21: {region: 0x4152, code: 0xd, from: 0xf82ce, to: 0xf9021}, + 22: {region: 0x4152, code: 0x10, from: 0xf7ec1, to: 0xf82ce}, + 23: {region: 0x4152, code: 0xe, from: 0xf6421, to: 0xf7ec1}, + 24: {region: 0x4152, code: 0xf, from: 0xeb365, to: 0xf6421}, + 25: {region: 0x4153, code: 0xfc, from: 0xee0f0, to: 0x0}, + 26: {region: 0x4154, code: 0x5e, from: 0xf9e21, to: 0x0}, + 27: {region: 0x4154, code: 0x12, from: 0xf3784, to: 0xfa45c}, + 28: {region: 0x4155, code: 0x13, from: 0xf5c4e, to: 0x0}, + 29: {region: 0x4157, code: 0x14, from: 0xf8421, to: 0x0}, + 30: {region: 0x4157, code: 0x8, from: 0xf28aa, to: 0xf8421}, + 31: {region: 0x4158, code: 0x5e, from: 0xf9e21, to: 0x0}, + 32: {region: 0x415a, code: 0x16, from: 0xfac21, to: 0x0}, + 33: {region: 0x415a, code: 0x15, from: 0xf9376, to: 0xfad9f}, + 34: {region: 0x415a, code: 0xd3, from: 0xf8f99, to: 0xf9421}, + 35: {region: 0x415a, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 36: {region: 0x4241, code: 0x18, from: 0xf9621, to: 0x0}, + 37: {region: 0x4241, code: 0x19, from: 0xf950f, to: 0xf9ae1}, + 38: {region: 0x4241, code: 0x17, from: 0xf90e1, to: 0xf950f}, + 39: {region: 0x4241, code: 0x123, from: 0xf90e1, to: 0xf9341}, + 40: {region: 0x4241, code: 0x122, from: 0xf8c21, to: 0xf90e1}, + 41: {region: 0x4241, code: 0x120, from: 0xf5c21, to: 0xf8c21}, + 42: {region: 0x4242, code: 0x1a, from: 0xf6b83, to: 0x0}, + 43: {region: 0x4242, code: 0x110, from: 0xf5b46, to: 0xf6b83}, + 44: {region: 0x4244, code: 0x1b, from: 0xf6821, to: 0x0}, + 45: {region: 0x4244, code: 0xc8, from: 0xf3881, to: 0xf6821}, + 46: {region: 0x4244, code: 0x7d, from: 0xe5711, to: 0xf3881}, + 47: {region: 0x4245, code: 0x5e, from: 0xf9e21, to: 0x0}, + 48: {region: 0x4245, code: 0x1d, from: 0xe4e47, to: 0xfa45c}, + 49: {region: 0x4245, code: 0xbd, from: 0xe318f, to: 0xe4e47}, + 50: {region: 0x4245, code: 0x801e, from: 0xf6421, to: 0xf8c65}, + 51: {region: 0x4245, code: 0x801c, from: 0xf6421, to: 0xf8c65}, + 52: {region: 0x4246, code: 0x115, from: 0xf8104, to: 0x0}, + 53: {region: 0x4247, code: 0x21, from: 0xf9ee5, to: 0x0}, + 54: {region: 0x4247, code: 0x1f, from: 0xf5421, to: 0xf9ee5}, + 55: {region: 0x4247, code: 0x20, from: 0xf40ac, to: 0xf5421}, + 56: {region: 0x4247, code: 0x22, from: 0xeaee8, to: 0xf40ac}, + 57: {region: 0x4248, code: 0x23, from: 0xf5b50, to: 0x0}, + 58: {region: 0x4249, code: 0x24, from: 0xf58b3, to: 0x0}, + 59: {region: 0x424a, code: 0x115, from: 0xf6f7e, to: 0x0}, + 60: {region: 0x424c, code: 0x5e, from: 0xf9e21, to: 0x0}, + 61: {region: 0x424c, code: 0x62, from: 0xf5021, to: 0xfa451}, + 62: {region: 0x424d, code: 0x25, from: 0xf6446, to: 0x0}, + 63: {region: 0x424e, code: 0x26, from: 0xf5ecc, to: 0x0}, + 64: {region: 0x424e, code: 0xb5, from: 0xf5730, to: 0xf5ecc}, + 65: {region: 0x424f, code: 0x27, from: 0xf8621, to: 0x0}, + 66: {region: 0x424f, code: 0x29, from: 0xf5621, to: 0xf859f}, + 67: {region: 0x424f, code: 0x28, from: 0xe8ed7, to: 0xf5621}, + 68: {region: 0x424f, code: 0x802a, from: 0x0, to: 0x0}, + 69: {region: 0x4251, code: 0xfc, from: 0xfb621, to: 0x0}, + 70: {region: 0x4251, code: 0x8, from: 0xfb54a, to: 0xfb621}, + 71: {region: 0x4252, code: 0x2e, from: 0xf94e1, to: 0x0}, + 72: {region: 0x4252, code: 0x30, from: 0xf9301, to: 0xf94e1}, + 73: {region: 0x4252, code: 0x2d, from: 0xf8c70, to: 0xf9301}, + 74: {region: 0x4252, code: 0x2f, from: 0xf8a2f, to: 0xf8c70}, + 75: {region: 0x4252, code: 0x2c, from: 0xf845c, to: 0xf8a2f}, + 76: {region: 0x4252, code: 0x2b, from: 0xf5e4d, to: 0xf845c}, + 77: {region: 0x4252, code: 0x31, from: 0xf2d61, to: 0xf5e4d}, + 78: {region: 0x4253, code: 0x32, from: 0xf5cb9, to: 0x0}, + 79: {region: 0x4254, code: 0x33, from: 0xf6c90, to: 0x0}, + 80: {region: 0x4254, code: 0x7d, from: 0xee621, to: 0x0}, + 81: {region: 0x4255, code: 0x34, from: 0xf40e1, to: 0xf8ad2}, + 82: {region: 0x4256, code: 0xbe, from: 0xee2c7, to: 0x0}, + 83: {region: 0x4257, code: 0x35, from: 0xf7117, to: 0x0}, + 84: {region: 0x4257, code: 0x125, from: 0xf524e, to: 0xf7117}, + 85: {region: 0x4259, code: 0x37, from: 0xfc0e1, to: 0x0}, + 86: {region: 0x4259, code: 0x38, from: 0xfa021, to: 0xfc221}, + 87: {region: 0x4259, code: 0x36, from: 0xf9501, to: 0xfa19f}, + 88: {region: 0x4259, code: 0xd3, from: 0xf8f99, to: 0xf9568}, + 89: {region: 0x4259, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 90: {region: 0x425a, code: 0x39, from: 0xf6c21, to: 0x0}, + 91: {region: 0x4341, code: 0x3a, from: 0xe8421, to: 0x0}, + 92: {region: 0x4343, code: 0x13, from: 0xf5c4e, to: 0x0}, + 93: {region: 0x4344, code: 0x3b, from: 0xf9ce1, to: 0x0}, + 94: {region: 0x4344, code: 0x128, from: 0xf9361, to: 0xf9ce1}, + 95: {region: 0x4344, code: 0x129, from: 0xf675b, to: 0xf9361}, + 96: {region: 0x4346, code: 0x109, from: 0xf9221, to: 0x0}, + 97: {region: 0x4347, code: 0x109, from: 0xf9221, to: 0x0}, + 98: {region: 0x4348, code: 0x3d, from: 0xe0e71, to: 0x0}, + 99: {region: 0x4348, code: 0x803c, from: 0x0, to: 0x0}, + 100: {region: 0x4348, code: 0x803e, from: 0x0, to: 0x0}, + 101: {region: 0x4349, code: 0x115, from: 0xf4d84, to: 0x0}, + 102: {region: 0x434b, code: 0xc0, from: 0xf5eea, to: 0x0}, + 103: {region: 0x434c, code: 0x41, from: 0xf6f3d, to: 0x0}, + 104: {region: 0x434c, code: 0x3f, from: 0xf5021, to: 0xf6f3d}, + 105: {region: 0x434c, code: 0x8040, from: 0x0, to: 0x0}, + 106: {region: 0x434d, code: 0x109, from: 0xf6a81, to: 0x0}, + 107: {region: 0x434e, code: 0x44, from: 0xf4261, to: 0x0}, + 108: {region: 0x434e, code: 0x8043, from: 0xf7621, to: 0xf9d9f}, + 109: {region: 0x434e, code: 0x8042, from: 0xfb4f3, to: 0x0}, + 110: {region: 0x434f, code: 0x45, from: 0xee221, to: 0x0}, + 111: {region: 0x434f, code: 0x8046, from: 0x0, to: 0x0}, + 112: {region: 0x4350, code: 0x811d, from: 0x0, to: 0x0}, + 113: {region: 0x4352, code: 0x47, from: 0xed15a, to: 0x0}, + 114: {region: 0x4353, code: 0x48, from: 0xfa4af, to: 0xfacc3}, + 115: {region: 0x4353, code: 0x5e, from: 0xfa644, to: 0xfacc3}, + 116: {region: 0x4353, code: 0x121, from: 0xf9438, to: 0xfa4af}, + 117: {region: 0x4355, code: 0x4b, from: 0xe8621, to: 0x0}, + 118: {region: 0x4355, code: 0x4a, from: 0xf9421, to: 0x0}, + 119: {region: 0x4355, code: 0xfc, from: 0xed621, to: 0xf4e21}, + 120: {region: 0x4356, code: 0x4c, from: 0xef421, to: 0x0}, + 121: {region: 0x4356, code: 0xcb, from: 0xeeeb6, to: 0xf6ee5}, + 122: {region: 0x4357, code: 0x8, from: 0xfb54a, to: 0x0}, + 123: {region: 0x4358, code: 0x13, from: 0xf5c4e, to: 0x0}, + 124: {region: 0x4359, code: 0x5e, from: 0xfb021, to: 0x0}, + 125: {region: 0x4359, code: 0x4d, from: 0xef52a, to: 0xfb03f}, + 126: {region: 0x435a, code: 0x4e, from: 0xf9221, to: 0x0}, + 127: {region: 0x435a, code: 0x49, from: 0xf42c1, to: 0xf9261}, + 128: {region: 0x4444, code: 0x4f, from: 0xf38f4, to: 0xf8d42}, + 129: {region: 0x4445, code: 0x5e, from: 0xf9e21, to: 0x0}, + 130: {region: 0x4445, code: 0x50, from: 0xf38d4, to: 0xfa45c}, + 131: {region: 0x4447, code: 0xfc, from: 0xf5b68, to: 0x0}, + 132: {region: 0x444a, code: 0x51, from: 0xf72db, to: 0x0}, + 133: {region: 0x444b, code: 0x52, from: 0xea2bb, to: 0x0}, + 134: {region: 0x444d, code: 0x110, from: 0xf5b46, to: 0x0}, + 135: {region: 0x444f, code: 0x53, from: 0xf3741, to: 0x0}, + 136: {region: 0x444f, code: 0xfc, from: 0xee2d5, to: 0xf3741}, + 137: {region: 0x445a, code: 0x54, from: 0xf5881, to: 0x0}, + 138: {region: 0x4541, code: 0x5e, from: 0xf9e21, to: 0x0}, + 139: {region: 0x4543, code: 0xfc, from: 0xfa142, to: 0x0}, + 140: {region: 0x4543, code: 0x55, from: 0xeb881, to: 0xfa142}, + 141: {region: 0x4543, code: 0x8056, from: 0xf92b7, to: 0xfa029}, + 142: {region: 0x4545, code: 0x5e, from: 0xfb621, to: 0x0}, + 143: {region: 0x4545, code: 0x57, from: 0xf90d5, to: 0xfb59f}, + 144: {region: 0x4545, code: 0xe7, from: 0xf5221, to: 0xf90d4}, + 145: {region: 0x4547, code: 0x58, from: 0xebb6e, to: 0x0}, + 146: {region: 0x4548, code: 0x9e, from: 0xf705a, to: 0x0}, + 147: {region: 0x4552, code: 0x59, from: 0xf9b68, to: 0x0}, + 148: {region: 0x4552, code: 0x5d, from: 0xf92b8, to: 0xf9b68}, + 149: {region: 0x4553, code: 0x5e, from: 0xf9e21, to: 0x0}, + 150: {region: 0x4553, code: 0x5c, from: 0xe9953, to: 0xfa45c}, + 151: {region: 0x4553, code: 0x805a, from: 0xf7421, to: 0xf7b9f}, + 152: {region: 0x4553, code: 0x805b, from: 0xf6e21, to: 0xf959f}, + 153: {region: 0x4554, code: 0x5d, from: 0xf712f, to: 0x0}, + 154: {region: 0x4555, code: 0x5e, from: 0xf9e21, to: 0x0}, + 155: {region: 0x4555, code: 0x8112, from: 0xf7621, to: 0xf9d9f}, + 156: {region: 0x4649, code: 0x5e, from: 0xf9e21, to: 0x0}, + 157: {region: 0x4649, code: 0x5f, from: 0xf5621, to: 0xfa45c}, + 158: {region: 0x464a, code: 0x60, from: 0xf622d, to: 0x0}, + 159: {region: 0x464b, code: 0x61, from: 0xeda21, to: 0x0}, + 160: {region: 0x464d, code: 0xfc, from: 0xf3021, to: 0x0}, + 161: {region: 0x464d, code: 0x85, from: 0xef543, to: 0xf3021}, + 162: {region: 0x464f, code: 0x52, from: 0xf3821, to: 0x0}, + 163: {region: 0x4652, code: 0x5e, from: 0xf9e21, to: 0x0}, + 164: {region: 0x4652, code: 0x62, from: 0xf5021, to: 0xfa451}, + 165: {region: 0x4741, code: 0x109, from: 0xf9221, to: 0x0}, + 166: {region: 0x4742, code: 0x63, from: 0xd3cfb, to: 0x0}, + 167: {region: 0x4744, code: 0x110, from: 0xf5e5b, to: 0x0}, + 168: {region: 0x4745, code: 0x65, from: 0xf9737, to: 0x0}, + 169: {region: 0x4745, code: 0x64, from: 0xf9285, to: 0xf9739}, + 170: {region: 0x4745, code: 0xd3, from: 0xf8f99, to: 0xf92cb}, + 171: {region: 0x4745, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 172: {region: 0x4746, code: 0x5e, from: 0xf9e21, to: 0x0}, + 173: {region: 0x4746, code: 0x62, from: 0xf5021, to: 0xfa451}, + 174: {region: 0x4747, code: 0x63, from: 0xe4c21, to: 0x0}, + 175: {region: 0x4748, code: 0x67, from: 0xfaee3, to: 0x0}, + 176: {region: 0x4748, code: 0x66, from: 0xf7669, to: 0xfaf9f}, + 177: {region: 0x4749, code: 0x68, from: 0xd6221, to: 0x0}, + 178: {region: 0x474c, code: 0x52, from: 0xea2bb, to: 0x0}, + 179: {region: 0x474d, code: 0x69, from: 0xf66e1, to: 0x0}, + 180: {region: 0x474e, code: 0x6a, from: 0xf8426, to: 0x0}, + 181: {region: 0x474e, code: 0x6b, from: 0xf6942, to: 0xf8426}, + 182: {region: 0x4750, code: 0x5e, from: 0xf9e21, to: 0x0}, + 183: {region: 0x4750, code: 0x62, from: 0xf5021, to: 0xfa451}, + 184: {region: 0x4751, code: 0x109, from: 0xf9221, to: 0x0}, + 185: {region: 0x4751, code: 0x6c, from: 0xf6ee7, to: 0xf84c1}, + 186: {region: 0x4752, code: 0x5e, from: 0xfa221, to: 0x0}, + 187: {region: 0x4752, code: 0x6d, from: 0xf44a1, to: 0xfa45c}, + 188: {region: 0x4753, code: 0x63, from: 0xee821, to: 0x0}, + 189: {region: 0x4754, code: 0x6e, from: 0xf0abb, to: 0x0}, + 190: {region: 0x4755, code: 0xfc, from: 0xf3115, to: 0x0}, + 191: {region: 0x4757, code: 0x115, from: 0xf9a7f, to: 0x0}, + 192: {region: 0x4757, code: 0x70, from: 0xf705c, to: 0xf9a7f}, + 193: {region: 0x4757, code: 0x6f, from: 0xef421, to: 0xf705c}, + 194: {region: 0x4759, code: 0x71, from: 0xf5cba, to: 0x0}, + 195: {region: 0x484b, code: 0x72, from: 0xece42, to: 0x0}, + 196: {region: 0x484d, code: 0x13, from: 0xf5e50, to: 0x0}, + 197: {region: 0x484e, code: 0x73, from: 0xf0c83, to: 0x0}, + 198: {region: 0x4852, code: 0x75, from: 0xf94be, to: 0x0}, + 199: {region: 0x4852, code: 0x74, from: 0xf8f97, to: 0xf9621}, + 200: {region: 0x4852, code: 0x122, from: 0xf8c21, to: 0xf8f97}, + 201: {region: 0x4852, code: 0x120, from: 0xf5c21, to: 0xf8c21}, + 202: {region: 0x4854, code: 0x76, from: 0xea11a, to: 0x0}, + 203: {region: 0x4854, code: 0xfc, from: 0xef621, to: 0x0}, + 204: {region: 0x4855, code: 0x77, from: 0xf34f7, to: 0x0}, + 205: {region: 0x4943, code: 0x5e, from: 0xf9e21, to: 0x0}, + 206: {region: 0x4944, code: 0x78, from: 0xf5b8d, to: 0x0}, + 207: {region: 0x4945, code: 0x5e, from: 0xf9e21, to: 0x0}, + 208: {region: 0x4945, code: 0x79, from: 0xf0421, to: 0xfa449}, + 209: {region: 0x4945, code: 0x63, from: 0xe1021, to: 0xf0421}, + 210: {region: 0x494c, code: 0x7c, from: 0xf8324, to: 0x0}, + 211: {region: 0x494c, code: 0x7b, from: 0xf7856, to: 0xf8324}, + 212: {region: 0x494c, code: 0x7a, from: 0xf3910, to: 0xf7856}, + 213: {region: 0x494d, code: 0x63, from: 0xe6023, to: 0x0}, + 214: {region: 0x494e, code: 0x7d, from: 0xe5711, to: 0x0}, + 215: {region: 0x494f, code: 0xfc, from: 0xf5b68, to: 0x0}, + 216: {region: 0x4951, code: 0x7e, from: 0xf1693, to: 0x0}, + 217: {region: 0x4951, code: 0x58, from: 0xf016b, to: 0xf1693}, + 218: {region: 0x4951, code: 0x7d, from: 0xf016b, to: 0xf1693}, + 219: {region: 0x4952, code: 0x7f, from: 0xf18ad, to: 0x0}, + 220: {region: 0x4953, code: 0x81, from: 0xf7a21, to: 0x0}, + 221: {region: 0x4953, code: 0x80, from: 0xefd81, to: 0xf7a21}, + 222: {region: 0x4953, code: 0x52, from: 0xea2bb, to: 0xefd81}, + 223: {region: 0x4954, code: 0x5e, from: 0xf9e21, to: 0x0}, + 224: {region: 0x4954, code: 0x82, from: 0xe8d18, to: 0xfa45c}, + 225: {region: 0x4a45, code: 0x63, from: 0xe5a21, to: 0x0}, + 226: {region: 0x4a4d, code: 0x83, from: 0xf6328, to: 0x0}, + 227: {region: 0x4a4f, code: 0x84, from: 0xf3ce1, to: 0x0}, + 228: {region: 0x4a50, code: 0x85, from: 0xe9ec1, to: 0x0}, + 229: {region: 0x4b45, code: 0x86, from: 0xf5d2e, to: 0x0}, + 230: {region: 0x4b47, code: 0x87, from: 0xf92aa, to: 0x0}, + 231: {region: 0x4b47, code: 0xd3, from: 0xf8f99, to: 0xf92aa}, + 232: {region: 0x4b47, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 233: {region: 0x4b48, code: 0x88, from: 0xf7874, to: 0x0}, + 234: {region: 0x4b49, code: 0x13, from: 0xf5c4e, to: 0x0}, + 235: {region: 0x4b4d, code: 0x89, from: 0xf6ee6, to: 0x0}, + 236: {region: 0x4b4e, code: 0x110, from: 0xf5b46, to: 0x0}, + 237: {region: 0x4b50, code: 0x8a, from: 0xf4e91, to: 0x0}, + 238: {region: 0x4b52, code: 0x8d, from: 0xf54ca, to: 0x0}, + 239: {region: 0x4b52, code: 0x8b, from: 0xf424f, to: 0xf54ca}, + 240: {region: 0x4b52, code: 0x8c, from: 0xf330f, to: 0xf424f}, + 241: {region: 0x4b57, code: 0x8e, from: 0xf5281, to: 0x0}, + 242: {region: 0x4b59, code: 0x8f, from: 0xf6621, to: 0x0}, + 243: {region: 0x4b59, code: 0x83, from: 0xf6328, to: 0xf6621}, + 244: {region: 0x4b5a, code: 0x90, from: 0xf9365, to: 0x0}, + 245: {region: 0x4c41, code: 0x91, from: 0xf778a, to: 0x0}, + 246: {region: 0x4c42, code: 0x92, from: 0xf3842, to: 0x0}, + 247: {region: 0x4c43, code: 0x110, from: 0xf5b46, to: 0x0}, + 248: {region: 0x4c49, code: 0x3d, from: 0xf0241, to: 0x0}, + 249: {region: 0x4c4b, code: 0x93, from: 0xf74b6, to: 0x0}, + 250: {region: 0x4c52, code: 0x94, from: 0xf3021, to: 0x0}, + 251: {region: 0x4c53, code: 0x125, from: 0xf524e, to: 0x0}, + 252: {region: 0x4c53, code: 0x95, from: 0xf7836, to: 0x0}, + 253: {region: 0x4c54, code: 0x5e, from: 0xfbe21, to: 0x0}, + 254: {region: 0x4c54, code: 0x96, from: 0xf92d9, to: 0xfbd9f}, + 255: {region: 0x4c54, code: 0x97, from: 0xf9141, to: 0xf92d9}, + 256: {region: 0x4c54, code: 0xe7, from: 0xf5221, to: 0xf9141}, + 257: {region: 0x4c55, code: 0x5e, from: 0xf9e21, to: 0x0}, + 258: {region: 0x4c55, code: 0x99, from: 0xf3124, to: 0xfa45c}, + 259: {region: 0x4c55, code: 0x8098, from: 0xf6421, to: 0xf8c65}, + 260: {region: 0x4c55, code: 0x809a, from: 0xf6421, to: 0xf8c65}, + 261: {region: 0x4c56, code: 0x5e, from: 0xfbc21, to: 0x0}, + 262: {region: 0x4c56, code: 0x9b, from: 0xf92dc, to: 0xfbb9f}, + 263: {region: 0x4c56, code: 0x9c, from: 0xf90a7, to: 0xf9351}, + 264: {region: 0x4c56, code: 0xe7, from: 0xf5221, to: 0xf90f4}, + 265: {region: 0x4c59, code: 0x9d, from: 0xf6721, to: 0x0}, + 266: {region: 0x4d41, code: 0x9e, from: 0xf4f51, to: 0x0}, + 267: {region: 0x4d41, code: 0x9f, from: 0xeb221, to: 0xf4f51}, + 268: {region: 0x4d43, code: 0x5e, from: 0xf9e21, to: 0x0}, + 269: {region: 0x4d43, code: 0x62, from: 0xf5021, to: 0xfa451}, + 270: {region: 0x4d43, code: 0xa0, from: 0xf5021, to: 0xfa451}, + 271: {region: 0x4d44, code: 0xa2, from: 0xf937d, to: 0x0}, + 272: {region: 0x4d44, code: 0xa1, from: 0xf90c1, to: 0xf937d}, + 273: {region: 0x4d45, code: 0x5e, from: 0xfa421, to: 0x0}, + 274: {region: 0x4d45, code: 0x50, from: 0xf9f42, to: 0xfa4af}, + 275: {region: 0x4d45, code: 0x121, from: 0xf9438, to: 0xfa4af}, + 276: {region: 0x4d46, code: 0x5e, from: 0xf9e21, to: 0x0}, + 277: {region: 0x4d46, code: 0x62, from: 0xf5021, to: 0xfa451}, + 278: {region: 0x4d47, code: 0xa3, from: 0xf7f61, to: 0x0}, + 279: {region: 0x4d47, code: 0xa4, from: 0xf56e1, to: 0xfa99f}, + 280: {region: 0x4d48, code: 0xfc, from: 0xf3021, to: 0x0}, + 281: {region: 0x4d4b, code: 0xa5, from: 0xf92b4, to: 0x0}, + 282: {region: 0x4d4b, code: 0xa6, from: 0xf909a, to: 0xf92b4}, + 283: {region: 0x4d4c, code: 0x115, from: 0xf80c1, to: 0x0}, + 284: {region: 0x4d4c, code: 0xa7, from: 0xf54e2, to: 0xf811f}, + 285: {region: 0x4d4c, code: 0x115, from: 0xf4d78, to: 0xf54e2}, + 286: {region: 0x4d4d, code: 0xa8, from: 0xf8ad2, to: 0x0}, + 287: {region: 0x4d4d, code: 0x34, from: 0xf40e1, to: 0xf8ad2}, + 288: {region: 0x4d4e, code: 0xa9, from: 0xef661, to: 0x0}, + 289: {region: 0x4d4f, code: 0xaa, from: 0xeda21, to: 0x0}, + 290: {region: 0x4d50, code: 0xfc, from: 0xf3021, to: 0x0}, + 291: {region: 0x4d51, code: 0x5e, from: 0xf9e21, to: 0x0}, + 292: {region: 0x4d51, code: 0x62, from: 0xf5021, to: 0xfa451}, + 293: {region: 0x4d52, code: 0xab, from: 0xf6add, to: 0x0}, + 294: {region: 0x4d52, code: 0x115, from: 0xf4d7c, to: 0xf6add}, + 295: {region: 0x4d53, code: 0x110, from: 0xf5e5b, to: 0x0}, + 296: {region: 0x4d54, code: 0x5e, from: 0xfb021, to: 0x0}, + 297: {region: 0x4d54, code: 0xac, from: 0xf60c7, to: 0xfb03f}, + 298: {region: 0x4d54, code: 0xad, from: 0xef50d, to: 0xf60c7}, + 299: {region: 0x4d55, code: 0xae, from: 0xf1c81, to: 0x0}, + 300: {region: 0x4d56, code: 0xb0, from: 0xf7ae1, to: 0x0}, + 301: {region: 0x4d57, code: 0xb1, from: 0xf664f, to: 0x0}, + 302: {region: 0x4d58, code: 0xb2, from: 0xf9221, to: 0x0}, + 303: {region: 0x4d58, code: 0xb3, from: 0xe3c21, to: 0xf919f}, + 304: {region: 0x4d58, code: 0x80b4, from: 0x0, to: 0x0}, + 305: {region: 0x4d59, code: 0xb5, from: 0xf5730, to: 0x0}, + 306: {region: 0x4d5a, code: 0xb8, from: 0xface1, to: 0x0}, + 307: {region: 0x4d5a, code: 0xb7, from: 0xf78d0, to: 0xfad9f}, + 308: {region: 0x4d5a, code: 0xb6, from: 0xf6ed9, to: 0xf78d0}, + 309: {region: 0x4e41, code: 0xb9, from: 0xf9221, to: 0x0}, + 310: {region: 0x4e41, code: 0x125, from: 0xf524e, to: 0x0}, + 311: {region: 0x4e43, code: 0x117, from: 0xf8221, to: 0x0}, + 312: {region: 0x4e45, code: 0x115, from: 0xf4d93, to: 0x0}, + 313: {region: 0x4e46, code: 0x13, from: 0xf5c4e, to: 0x0}, + 314: {region: 0x4e47, code: 0xba, from: 0xf6a21, to: 0x0}, + 315: {region: 0x4e49, code: 0xbc, from: 0xf8e9e, to: 0x0}, + 316: {region: 0x4e49, code: 0xbb, from: 0xf884f, to: 0xf8e9e}, + 317: {region: 0x4e4c, code: 0x5e, from: 0xf9e21, to: 0x0}, + 318: {region: 0x4e4c, code: 0xbd, from: 0xe2a21, to: 0xfa45c}, + 319: {region: 0x4e4f, code: 0xbe, from: 0xee2c7, to: 0x0}, + 320: {region: 0x4e4f, code: 0xdb, from: 0xea2bb, to: 0xee2c7}, + 321: {region: 0x4e50, code: 0xbf, from: 0xf1a21, to: 0x0}, + 322: {region: 0x4e50, code: 0x7d, from: 0xe9c21, to: 0xf5d51}, + 323: {region: 0x4e52, code: 0x13, from: 0xf5c4e, to: 0x0}, + 324: {region: 0x4e55, code: 0xc0, from: 0xf5eea, to: 0x0}, + 325: {region: 0x4e5a, code: 0xc0, from: 0xf5eea, to: 0x0}, + 326: {region: 0x4f4d, code: 0xc1, from: 0xf696b, to: 0x0}, + 327: {region: 0x5041, code: 0xc2, from: 0xedf64, to: 0x0}, + 328: {region: 0x5041, code: 0xfc, from: 0xedf72, to: 0x0}, + 329: {region: 0x5045, code: 0xc4, from: 0xf8ee1, to: 0x0}, + 330: {region: 0x5045, code: 0xc3, from: 0xf8241, to: 0xf8ee1}, + 331: {region: 0x5045, code: 0xc5, from: 0xe8e4e, to: 0xf8241}, + 332: {region: 0x5046, code: 0x117, from: 0xf339a, to: 0x0}, + 333: {region: 0x5047, code: 0xc6, from: 0xf6f30, to: 0x0}, + 334: {region: 0x5047, code: 0x13, from: 0xf5c4e, to: 0xf6f30}, + 335: {region: 0x5048, code: 0xc7, from: 0xf34e4, to: 0x0}, + 336: {region: 0x504b, code: 0xc8, from: 0xf3881, to: 0x0}, + 337: {region: 0x504b, code: 0x7d, from: 0xe5711, to: 0xf370f}, + 338: {region: 0x504c, code: 0xc9, from: 0xf9621, to: 0x0}, + 339: {region: 0x504c, code: 0xca, from: 0xf3d5c, to: 0xf959f}, + 340: {region: 0x504d, code: 0x5e, from: 0xf9e21, to: 0x0}, + 341: {region: 0x504d, code: 0x62, from: 0xf6995, to: 0xfa451}, + 342: {region: 0x504e, code: 0xc0, from: 0xf622d, to: 0x0}, + 343: {region: 0x5052, code: 0xfc, from: 0xed58a, to: 0x0}, + 344: {region: 0x5052, code: 0x5c, from: 0xe1021, to: 0xed58a}, + 345: {region: 0x5053, code: 0x7c, from: 0xf8324, to: 0x0}, + 346: {region: 0x5053, code: 0x84, from: 0xf984c, to: 0x0}, + 347: {region: 0x5053, code: 0x7a, from: 0xf5ec1, to: 0xf7856}, + 348: {region: 0x5053, code: 0x84, from: 0xf3ce1, to: 0xf5ec1}, + 349: {region: 0x5054, code: 0x5e, from: 0xf9e21, to: 0x0}, + 350: {region: 0x5054, code: 0xcb, from: 0xeeeb6, to: 0xfa45c}, + 351: {region: 0x5057, code: 0xfc, from: 0xf3021, to: 0x0}, + 352: {region: 0x5059, code: 0xcc, from: 0xf2f61, to: 0x0}, + 353: {region: 0x5141, code: 0xcd, from: 0xf6ab3, to: 0x0}, + 354: {region: 0x5245, code: 0x5e, from: 0xf9e21, to: 0x0}, + 355: {region: 0x5245, code: 0x62, from: 0xf6e21, to: 0xfa451}, + 356: {region: 0x524f, code: 0xd0, from: 0xfaae1, to: 0x0}, + 357: {region: 0x524f, code: 0xcf, from: 0xf403c, to: 0xfad9f}, + 358: {region: 0x5253, code: 0xd1, from: 0xfad59, to: 0x0}, + 359: {region: 0x5253, code: 0x48, from: 0xfa4af, to: 0xfad59}, + 360: {region: 0x5253, code: 0x121, from: 0xf9438, to: 0xfa4af}, + 361: {region: 0x5255, code: 0xd2, from: 0xf9e21, to: 0x0}, + 362: {region: 0x5255, code: 0xd3, from: 0xf8f99, to: 0xf9d9f}, + 363: {region: 0x5257, code: 0xd4, from: 0xf58b3, to: 0x0}, + 364: {region: 0x5341, code: 0xd5, from: 0xf4156, to: 0x0}, + 365: {region: 0x5342, code: 0xd6, from: 0xf7358, to: 0x0}, + 366: {region: 0x5342, code: 0x13, from: 0xf5c4e, to: 0xf74de}, + 367: {region: 0x5343, code: 0xd7, from: 0xedf61, to: 0x0}, + 368: {region: 0x5344, code: 0xd9, from: 0xfae2a, to: 0x0}, + 369: {region: 0x5344, code: 0xd8, from: 0xf90c8, to: 0xfaede}, + 370: {region: 0x5344, code: 0xda, from: 0xf4a88, to: 0xf9cc1}, + 371: {region: 0x5344, code: 0x58, from: 0xec233, to: 0xf4c21}, + 372: {region: 0x5344, code: 0x63, from: 0xec233, to: 0xf4c21}, + 373: {region: 0x5345, code: 0xdb, from: 0xea2bb, to: 0x0}, + 374: {region: 0x5347, code: 0xdc, from: 0xf5ecc, to: 0x0}, + 375: {region: 0x5347, code: 0xb5, from: 0xf5730, to: 0xf5ecc}, + 376: {region: 0x5348, code: 0xdd, from: 0xefa4f, to: 0x0}, + 377: {region: 0x5349, code: 0x5e, from: 0xfae21, to: 0x0}, + 378: {region: 0x5349, code: 0xde, from: 0xf9147, to: 0xfae2e}, + 379: {region: 0x534a, code: 0xbe, from: 0xee2c7, to: 0x0}, + 380: {region: 0x534b, code: 0x5e, from: 0xfb221, to: 0x0}, + 381: {region: 0x534b, code: 0xdf, from: 0xf919f, to: 0xfb221}, + 382: {region: 0x534b, code: 0x49, from: 0xf42c1, to: 0xf919f}, + 383: {region: 0x534c, code: 0xe0, from: 0xf5904, to: 0x0}, + 384: {region: 0x534c, code: 0x63, from: 0xe217e, to: 0xf5c44}, + 385: {region: 0x534d, code: 0x5e, from: 0xf9e21, to: 0x0}, + 386: {region: 0x534d, code: 0x82, from: 0xe9397, to: 0xfa25c}, + 387: {region: 0x534e, code: 0x115, from: 0xf4e84, to: 0x0}, + 388: {region: 0x534f, code: 0xe1, from: 0xf50e1, to: 0x0}, + 389: {region: 0x5352, code: 0xe2, from: 0xfa821, to: 0x0}, + 390: {region: 0x5352, code: 0xe3, from: 0xf28aa, to: 0xfa79f}, + 391: {region: 0x5352, code: 0xbd, from: 0xe2f74, to: 0xf28aa}, + 392: {region: 0x5353, code: 0xe4, from: 0xfb6f2, to: 0x0}, + 393: {region: 0x5353, code: 0xd9, from: 0xfae2a, to: 0xfb721}, + 394: {region: 0x5354, code: 0xe6, from: 0xfc421, to: 0x0}, + 395: {region: 0x5354, code: 0xe5, from: 0xf7328, to: 0xfc39f}, + 396: {region: 0x5355, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 397: {region: 0x5356, code: 0xfc, from: 0xfa221, to: 0x0}, + 398: {region: 0x5356, code: 0xe8, from: 0xeff6b, to: 0xfa221}, + 399: {region: 0x5358, code: 0x8, from: 0xfb54a, to: 0x0}, + 400: {region: 0x5359, code: 0xe9, from: 0xf3821, to: 0x0}, + 401: {region: 0x535a, code: 0xea, from: 0xf6d26, to: 0x0}, + 402: {region: 0x5441, code: 0x63, from: 0xf242c, to: 0x0}, + 403: {region: 0x5443, code: 0xfc, from: 0xf6328, to: 0x0}, + 404: {region: 0x5444, code: 0x109, from: 0xf9221, to: 0x0}, + 405: {region: 0x5446, code: 0x5e, from: 0xf9e21, to: 0x0}, + 406: {region: 0x5446, code: 0x62, from: 0xf4e21, to: 0xfa451}, + 407: {region: 0x5447, code: 0x115, from: 0xf4d7c, to: 0x0}, + 408: {region: 0x5448, code: 0xeb, from: 0xf108f, to: 0x0}, + 409: {region: 0x544a, code: 0xed, from: 0xfa15a, to: 0x0}, + 410: {region: 0x544a, code: 0xec, from: 0xf96aa, to: 0xfa159}, + 411: {region: 0x544a, code: 0xd3, from: 0xf8f99, to: 0xf96aa}, + 412: {region: 0x544b, code: 0xc0, from: 0xf5eea, to: 0x0}, + 413: {region: 0x544c, code: 0xfc, from: 0xf9f54, to: 0x0}, + 414: {region: 0x544c, code: 0xf2, from: 0xf4e22, to: 0xfa4b4}, + 415: {region: 0x544c, code: 0x78, from: 0xf6f87, to: 0xfa4b4}, + 416: {region: 0x544d, code: 0xef, from: 0xfb221, to: 0x0}, + 417: {region: 0x544d, code: 0xee, from: 0xf9361, to: 0xfb221}, + 418: {region: 0x544d, code: 0xd3, from: 0xf8f99, to: 0xf9361}, + 419: {region: 0x544d, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 420: {region: 0x544e, code: 0xf0, from: 0xf4d61, to: 0x0}, + 421: {region: 0x544f, code: 0xf1, from: 0xf5c4e, to: 0x0}, + 422: {region: 0x5450, code: 0xf2, from: 0xf4e22, to: 0xfa4b4}, + 423: {region: 0x5450, code: 0x78, from: 0xf6f87, to: 0xfa4b4}, + 424: {region: 0x5452, code: 0xf4, from: 0xfaa21, to: 0x0}, + 425: {region: 0x5452, code: 0xf3, from: 0xf0561, to: 0xfab9f}, + 426: {region: 0x5454, code: 0xf5, from: 0xf5821, to: 0x0}, + 427: {region: 0x5456, code: 0x13, from: 0xf5c4e, to: 0x0}, + 428: {region: 0x5457, code: 0xf6, from: 0xf3acf, to: 0x0}, + 429: {region: 0x545a, code: 0xf7, from: 0xf5cce, to: 0x0}, + 430: {region: 0x5541, code: 0xf8, from: 0xf9922, to: 0x0}, + 431: {region: 0x5541, code: 0xf9, from: 0xf916d, to: 0xf9351}, + 432: {region: 0x5541, code: 0xd3, from: 0xf8f99, to: 0xf916d}, + 433: {region: 0x5541, code: 0xe7, from: 0xf5221, to: 0xf8f99}, + 434: {region: 0x5547, code: 0xfb, from: 0xf86af, to: 0x0}, + 435: {region: 0x5547, code: 0xfa, from: 0xf5d0f, to: 0xf86af}, + 436: {region: 0x554d, code: 0xfc, from: 0xf3021, to: 0x0}, + 437: {region: 0x5553, code: 0xfc, from: 0xe0021, to: 0x0}, + 438: {region: 0x5553, code: 0x80fd, from: 0x0, to: 0x0}, + 439: {region: 0x5553, code: 0x80fe, from: 0x0, to: 0xfbc61}, + 440: {region: 0x5559, code: 0x101, from: 0xf9261, to: 0x0}, + 441: {region: 0x5559, code: 0x100, from: 0xf6ee1, to: 0xf9261}, + 442: {region: 0x5559, code: 0x80ff, from: 0x0, to: 0x0}, + 443: {region: 0x555a, code: 0x102, from: 0xf94e1, to: 0x0}, + 444: {region: 0x5641, code: 0x5e, from: 0xf9e21, to: 0x0}, + 445: {region: 0x5641, code: 0x82, from: 0xe9d53, to: 0xfa45c}, + 446: {region: 0x5643, code: 0x110, from: 0xf5b46, to: 0x0}, + 447: {region: 0x5645, code: 0x104, from: 0xfb021, to: 0x0}, + 448: {region: 0x5645, code: 0x103, from: 0xe9eab, to: 0xfb0de}, + 449: {region: 0x5647, code: 0xfc, from: 0xe5221, to: 0x0}, + 450: {region: 0x5647, code: 0x63, from: 0xe5221, to: 0xf4e21}, + 451: {region: 0x5649, code: 0xfc, from: 0xe5a21, to: 0x0}, + 452: {region: 0x564e, code: 0x105, from: 0xf832e, to: 0x0}, + 453: {region: 0x564e, code: 0x106, from: 0xf74a3, to: 0xf832e}, + 454: {region: 0x5655, code: 0x107, from: 0xf7a21, to: 0x0}, + 455: {region: 0x5746, code: 0x117, from: 0xf52fe, to: 0x0}, + 456: {region: 0x5753, code: 0x108, from: 0xf5eea, to: 0x0}, + 457: {region: 0x584b, code: 0x5e, from: 0xfa421, to: 0x0}, + 458: {region: 0x584b, code: 0x50, from: 0xf9f21, to: 0xfa469}, + 459: {region: 0x584b, code: 0x121, from: 0xf9438, to: 0xf9f3e}, + 460: {region: 0x5944, code: 0x11e, from: 0xf5a81, to: 0xf9821}, + 461: {region: 0x5945, code: 0x11f, from: 0xf8cb6, to: 0x0}, + 462: {region: 0x5954, code: 0x5e, from: 0xf9e21, to: 0x0}, + 463: {region: 0x5954, code: 0x62, from: 0xf7057, to: 0xfa451}, + 464: {region: 0x5954, code: 0x89, from: 0xf6e21, to: 0xf7057}, + 465: {region: 0x5955, code: 0x121, from: 0xf9438, to: 0xfa4af}, + 466: {region: 0x5955, code: 0x122, from: 0xf8c21, to: 0xf90f8}, + 467: {region: 0x5955, code: 0x120, from: 0xf5c21, to: 0xf8c21}, + 468: {region: 0x5a41, code: 0x125, from: 0xf524e, to: 0x0}, + 469: {region: 0x5a41, code: 0x8124, from: 0xf8321, to: 0xf966d}, + 470: {region: 0x5a4d, code: 0x127, from: 0xfba21, to: 0x0}, + 471: {region: 0x5a4d, code: 0x126, from: 0xf6030, to: 0xfba21}, + 472: {region: 0x5a52, code: 0x128, from: 0xf9361, to: 0xf9cff}, + 473: {region: 0x5a52, code: 0x129, from: 0xf675b, to: 0xf9361}, + 474: {region: 0x5a57, code: 0xfc, from: 0xfb28c, to: 0x0}, + 475: {region: 0x5a57, code: 0x12b, from: 0xfb242, to: 0xfb28c}, + 476: {region: 0x5a57, code: 0x12c, from: 0xfb101, to: 0xfb242}, + 477: {region: 0x5a57, code: 0x12a, from: 0xf7892, to: 0xfb101}, + 478: {region: 0x5a57, code: 0xce, from: 0xf6451, to: 0xf7892}, + 479: {region: 0x5a5a, code: 0x810a, from: 0x0, to: 0x0}, + 480: {region: 0x5a5a, code: 0x810b, from: 0x0, to: 0x0}, + 481: {region: 0x5a5a, code: 0x810c, from: 0x0, to: 0x0}, + 482: {region: 0x5a5a, code: 0x810d, from: 0x0, to: 0x0}, + 483: {region: 0x5a5a, code: 0x810e, from: 0x0, to: 0x0}, + 484: {region: 0x5a5a, code: 0x810f, from: 0x0, to: 0x0}, + 485: {region: 0x5a5a, code: 0x8111, from: 0x0, to: 0x0}, + 486: {region: 0x5a5a, code: 0x8113, from: 0xf1421, to: 0xfa681}, + 487: {region: 0x5a5a, code: 0x8114, from: 0x0, to: 0xfbb7e}, + 488: {region: 0x5a5a, code: 0x8116, from: 0x0, to: 0x0}, + 489: {region: 0x5a5a, code: 0x8118, from: 0x0, to: 0x0}, + 490: {region: 0x5a5a, code: 0x8119, from: 0x0, to: 0xf9f7e}, + 491: {region: 0x5a5a, code: 0x811a, from: 0x0, to: 0x0}, + 492: {region: 0x5a5a, code: 0x811b, from: 0x0, to: 0x0}, + 493: {region: 0x5a5a, code: 0x811c, from: 0x0, to: 0x0}, + 494: {region: 0x5a5a, code: 0x811d, from: 0x0, to: 0x0}, +} // Size: 5964 bytes + +// symbols holds symbol data of the form , where n is the length of +// the symbol string str. +const symbols string = "" + // Size: 1445 bytes + "\x00\x02Kz\x01$\x02A$\x02KM\x03৳\x02Bs\x02R$\x01P\x03р.\x03CA$\x04CN¥" + + "\x02¥\x03₡\x03Kč\x02kr\x03E£\x03₧\x03€\x02£\x03₾\x02FG\x01Q\x03HK$\x01L" + + "\x02kn\x02Ft\x02Rp\x03₪\x03₹\x04JP¥\x03៛\x02CF\x03₩\x03₸\x03₭\x03L£\x02R" + + "s\x02Lt\x02Ls\x02Ar\x01K\x03₮\x03MX$\x02RM\x03₦\x02C$\x03NZ$\x03₱\x03zł" + + "\x03₲\x03lei\x03₽\x02RF\x02Db\x03฿\x02T$\x03₺\x03NT$\x03₴\x03US$\x03₫" + + "\x04FCFA\x03EC$\x03CFA\x04CFPF\x01R\x02ZK\x03leu\x05GH₵\x03AU$\x16የቻይና ዩ" + + "ዋን\x06ብር\x03***\x09د.إ.\u200f\x03AR$\x03BB$\x09د.ب.\u200f\x03BM$\x03BN" + + "$\x03BS$\x03BZ$\x03CL$\x03CO$\x03CU$\x03DO$\x09د.ج.\u200f\x09ج.م.\u200f" + + "\x03FJ$\x04UK£\x03GY$\x09د.ع.\u200f\x06ر.إ.\x03JM$\x09د.أ.\u200f\x09د.ك." + + "\u200f\x03KY$\x09ل.ل.\u200f\x09د.ل.\u200f\x09د.م.\u200f\x09أ.م.\u200f" + + "\x09ر.ع.\u200f\x09ر.ق.\u200f\x09ر.س.\u200f\x03SB$\x09د.س.\u200f\x06ج.س." + + "\x03SR$\x09ل.س.\u200f\x09د.ت.\u200f\x03TT$\x03UY$\x09ر.ي.\u200f\x03Fdj" + + "\x03Nfk\x01S\x04GB£\x03TSh\x03₼\x03ley\x03S£\x04Bds$\x03BD$\x02B$\x02Br" + + "\x04CUC$\x03$MN\x03RD$\x04FK£\x02G$\x04Íkr\x02J$\x03CI$\x02L$\x02N$\x07р" + + "уб.\x03SI$\x02S$\x02$U\x05лв.\x06щ.д.\x02$A\x03$CA\x04£ E\x05£ RU\x04$ " + + "HK\x03£L\x04$ ZN\x03$ T\x04$ SU\x04din.\x04КМ\x04Кч\x04зл\x07дин.\x04Тл" + + "\x01F\x06лей\x03USh\x04Kčs\x03ECU\x02TK\x03kr.\x03Ksh\x03öS\x03BGK\x03BG" + + "J\x04Cub$\x02DM\x04Fl£\x04F.G.\x02FC\x04F.Rw\x03Nu.\x05KR₩\x05TH฿\x06Δρχ" + + "\x02Tk\x02$b\x02Kr\x02Gs\x03CFP\x03FBu\x01D\x04MOP$\x02MK\x02SR\x02Le" + + "\x04NAf.\x01E\x02VT\x03WS$\x04SD£\x03BsF\x02p.\x03B/.\x02S/\x03Gs.\x03Bs" + + ".\x02؋\x04¥CN\x03$HK\x08ریال\x03$MX\x03$NZ\x03$EC\x02UM\x02mk\x03$AR\x03" + + "$AU\x02FB\x03$BM\x03$BN\x03$BS\x03$BZ\x03$CL\x03$CO\x04£CY\x03£E\x03$FJ" + + "\x04£FK\x04£GB\x04£GI\x04£IE\x04£IL\x05₤IT\x04£LB\x04£MT\x03$NA\x02$C" + + "\x03$RH\x02FR\x03$SB\x03$SG\x03$SR\x03$TT\x03$US\x03$UY\x04FCFP\x02Kw" + + "\x05$\u00a0AU\x05$\u00a0HK\x05$\u00a0NZ\x05$\u00a0SG\x05$\u00a0US\x02DA" + + "\x01G\x02LS\x02DT\x06руб\x07રૂ.\x0a\u200eCN¥\u200e\x06ל״י\x09लेई\x02֏" + + "\x03NKr\x03元\x03¥\x06レイ\x03\u200b\x06ಲೀ\x02LE\x02Kn\x06сом\x02zl\x02rb" + + "\x03MTn\x06ден\x04кр\x03NAf\x03Afl\x0cनेरू\x06रू\x04Afl.\x02ر\x03lej\x04" + + "Esc.\x06\u200bPTE\x04XXXX\x03ლ\x06ТМТ\x03Dkr\x03Skr\x03Nkr\x07රු.\x0fසිෆ" + + "්එ\x03NIS\x05Lekë\x03den\x02r.\x03BR$\x03Ekr\x04EG£\x04IE£\x03Ikr\x03R" + + "s.\x07сом.\x04AUD$\x04NZD$\x07крб.\x05soʻm\x06сўм\x03₩\x03ILS\x02P.\x03Z" + + "ł" + +type curToIndex struct { + cur uint16 + idx uint16 +} + +var normalLangIndex = []uint16{ // 776 elements + // Entry 0 - 3F + 0x0000, 0x0014, 0x0017, 0x0018, 0x0018, 0x0018, 0x0018, 0x0019, + 0x0019, 0x001d, 0x001d, 0x0034, 0x0034, 0x0034, 0x0034, 0x0035, + 0x0035, 0x0035, 0x0035, 0x0036, 0x0036, 0x0036, 0x0036, 0x0037, + 0x0037, 0x0038, 0x0038, 0x0038, 0x0038, 0x0038, 0x0038, 0x0038, + 0x0038, 0x0038, 0x0039, 0x003b, 0x003b, 0x003b, 0x003b, 0x003b, + 0x003b, 0x003b, 0x003b, 0x003c, 0x003c, 0x003f, 0x003f, 0x0041, + 0x0042, 0x0042, 0x0042, 0x0042, 0x0042, 0x0042, 0x0049, 0x0049, + 0x004a, 0x004a, 0x004b, 0x004b, 0x005c, 0x005c, 0x005c, 0x005c, + // Entry 40 - 7F + 0x005c, 0x005e, 0x005e, 0x005e, 0x005f, 0x005f, 0x0060, 0x006e, + 0x006e, 0x006e, 0x006e, 0x007f, 0x0085, 0x0085, 0x0085, 0x0085, + 0x008e, 0x008e, 0x008e, 0x008f, 0x008f, 0x0091, 0x0091, 0x0091, + 0x0092, 0x0092, 0x0093, 0x0093, 0x0094, 0x0094, 0x0095, 0x0095, + 0x0095, 0x009c, 0x009c, 0x009d, 0x009d, 0x009f, 0x009f, 0x00a3, + 0x00a3, 0x00a3, 0x00a4, 0x00a4, 0x00ac, 0x00ac, 0x00ac, 0x00ad, + 0x00ad, 0x00ad, 0x00ae, 0x00af, 0x00af, 0x00af, 0x00b4, 0x00b4, + 0x00b4, 0x00b4, 0x00b4, 0x00b4, 0x00b4, 0x00ba, 0x00ba, 0x00bb, + // Entry 80 - BF + 0x00bb, 0x00be, 0x00be, 0x00be, 0x00c1, 0x00c1, 0x00c1, 0x00c3, + 0x00c5, 0x00c5, 0x00c6, 0x00c7, 0x00c7, 0x00c7, 0x00dc, 0x00dd, + 0x00dd, 0x00de, 0x00df, 0x00e0, 0x00e1, 0x00e2, 0x00e3, 0x00e4, + 0x00e4, 0x00e5, 0x00e5, 0x00e6, 0x00e6, 0x00e6, 0x00e6, 0x00e7, + 0x00e8, 0x00e9, 0x00e9, 0x00ea, 0x00ec, 0x00ec, 0x00ec, 0x00ed, + 0x00ed, 0x00ee, 0x00f0, 0x00f1, 0x00f1, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f3, 0x00f4, 0x00f5, + 0x00f6, 0x00f7, 0x00f8, 0x00f9, 0x00fa, 0x00fb, 0x00fb, 0x00fc, + // Entry C0 - FF + 0x00fc, 0x00fd, 0x00fe, 0x00ff, 0x0100, 0x0101, 0x0102, 0x0103, + 0x0104, 0x0104, 0x0105, 0x0106, 0x0107, 0x0108, 0x0109, 0x010a, + 0x010b, 0x010b, 0x010b, 0x010c, 0x010d, 0x010e, 0x010e, 0x010f, + 0x0110, 0x0112, 0x0112, 0x0113, 0x0115, 0x0116, 0x0117, 0x0117, + 0x0118, 0x0119, 0x011a, 0x011b, 0x011c, 0x011d, 0x011d, 0x011d, + 0x011e, 0x011e, 0x011e, 0x011f, 0x0120, 0x0121, 0x0122, 0x0122, + 0x0122, 0x0122, 0x0133, 0x0138, 0x013a, 0x013b, 0x013c, 0x013d, + 0x013f, 0x0141, 0x0142, 0x0144, 0x0146, 0x0146, 0x0147, 0x0147, + // Entry 100 - 13F + 0x0148, 0x0149, 0x014a, 0x014a, 0x014b, 0x014c, 0x014d, 0x014e, + 0x014f, 0x0150, 0x0151, 0x0152, 0x0154, 0x0156, 0x0157, 0x015c, + 0x015c, 0x015e, 0x015e, 0x015e, 0x015e, 0x0169, 0x0169, 0x0169, + 0x0169, 0x0169, 0x016a, 0x016b, 0x016b, 0x017c, 0x017c, 0x0180, + 0x0180, 0x0181, 0x0182, 0x0182, 0x01a8, 0x01a8, 0x01a8, 0x01a9, + 0x01a9, 0x01a9, 0x01ca, 0x01cb, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x01cb, 0x01cc, 0x01cd, 0x01cd, 0x01cd, 0x01cd, 0x01ce, 0x01ce, + 0x01ce, 0x01cf, 0x01d0, 0x01d2, 0x01d2, 0x01d2, 0x01d2, 0x01d3, + // Entry 140 - 17F + 0x01d3, 0x01d3, 0x01d4, 0x01d5, 0x01d5, 0x01d5, 0x01d5, 0x01d5, + 0x01d5, 0x01d6, 0x01d7, 0x01d7, 0x01d8, 0x01d8, 0x01d8, 0x01d9, + 0x01da, 0x01da, 0x01da, 0x01da, 0x01da, 0x01e0, 0x01e0, 0x01e3, + 0x01e3, 0x01e5, 0x01e5, 0x01e9, 0x01e9, 0x01ec, 0x01ec, 0x01ec, + 0x01ec, 0x01ed, 0x01ed, 0x01ed, 0x01ee, 0x01ee, 0x01ee, 0x01ee, + 0x01ef, 0x01f0, 0x01f0, 0x01f0, 0x01f1, 0x01f1, 0x01f6, 0x01f6, + 0x01f8, 0x01f8, 0x020a, 0x020b, 0x020b, 0x0210, 0x0210, 0x0222, + 0x0222, 0x0225, 0x0225, 0x0229, 0x0229, 0x022a, 0x022a, 0x022b, + // Entry 180 - 1BF + 0x022b, 0x022b, 0x022b, 0x0237, 0x0237, 0x023f, 0x023f, 0x023f, + 0x023f, 0x023f, 0x023f, 0x023f, 0x0242, 0x0242, 0x0242, 0x0242, + 0x0242, 0x0242, 0x0243, 0x0243, 0x0243, 0x0243, 0x024d, 0x024d, + 0x024e, 0x024e, 0x024e, 0x024f, 0x024f, 0x024f, 0x0250, 0x0250, + 0x0253, 0x0253, 0x0253, 0x0253, 0x0254, 0x0254, 0x0258, 0x0258, + 0x0258, 0x0258, 0x0259, 0x0259, 0x025a, 0x025a, 0x025d, 0x025d, + 0x025f, 0x025f, 0x0260, 0x0260, 0x0260, 0x0260, 0x0260, 0x0260, + 0x0260, 0x0261, 0x0261, 0x0261, 0x0261, 0x0261, 0x0261, 0x0261, + // Entry 1C0 - 1FF + 0x0261, 0x0261, 0x0270, 0x0270, 0x0271, 0x0271, 0x0276, 0x0276, + 0x0277, 0x0277, 0x0278, 0x0278, 0x0279, 0x027a, 0x027a, 0x027a, + 0x027a, 0x027c, 0x027c, 0x027d, 0x027d, 0x027d, 0x0290, 0x0290, + 0x0291, 0x0291, 0x0292, 0x0292, 0x0293, 0x0293, 0x0298, 0x0298, + 0x0299, 0x0299, 0x029a, 0x029b, 0x029b, 0x029c, 0x029c, 0x029d, + 0x029d, 0x029e, 0x029e, 0x029e, 0x029e, 0x02aa, 0x02aa, 0x02ad, + 0x02ad, 0x02b0, 0x02b0, 0x02b0, 0x02b2, 0x02b2, 0x02b6, 0x02b7, + 0x02b7, 0x02b8, 0x02b8, 0x02b8, 0x02b8, 0x02b8, 0x02bf, 0x02bf, + // Entry 200 - 23F + 0x02c0, 0x02c0, 0x02c0, 0x02c1, 0x02c1, 0x02d3, 0x02d3, 0x02d3, + 0x02d3, 0x02d3, 0x02d3, 0x02d3, 0x02d3, 0x02d5, 0x02d5, 0x02d5, + 0x02db, 0x02dc, 0x02dc, 0x02dd, 0x02de, 0x02de, 0x02df, 0x02e0, + 0x02e0, 0x02e0, 0x02f3, 0x02f3, 0x02f3, 0x02f3, 0x02f3, 0x02f3, + 0x02f3, 0x02f3, 0x02f5, 0x02f5, 0x02f5, 0x02f6, 0x02f6, 0x02f7, + 0x02f7, 0x02f8, 0x02fa, 0x02fa, 0x02fc, 0x02fc, 0x02fe, 0x02ff, + 0x0300, 0x0300, 0x0300, 0x0300, 0x0300, 0x030f, 0x030f, 0x030f, + 0x030f, 0x0310, 0x0310, 0x0313, 0x0314, 0x0314, 0x0314, 0x0316, + // Entry 240 - 27F + 0x0316, 0x0316, 0x0317, 0x0318, 0x0319, 0x031a, 0x031b, 0x031b, + 0x031c, 0x031e, 0x0320, 0x0320, 0x0320, 0x0320, 0x0321, 0x0321, + 0x0332, 0x0333, 0x0333, 0x0334, 0x0334, 0x033c, 0x033e, 0x033f, + 0x0340, 0x0341, 0x0341, 0x0341, 0x0342, 0x0342, 0x0343, 0x0343, + 0x0344, 0x0344, 0x0345, 0x0345, 0x0346, 0x0346, 0x0347, 0x0347, + 0x0347, 0x034b, 0x034b, 0x034b, 0x034d, 0x034e, 0x034e, 0x034e, + 0x034e, 0x034e, 0x034e, 0x034e, 0x034e, 0x034e, 0x034e, 0x034e, + 0x034e, 0x0351, 0x0351, 0x035f, 0x035f, 0x0369, 0x0369, 0x0369, + // Entry 280 - 2BF + 0x0369, 0x0369, 0x0369, 0x0369, 0x0369, 0x0369, 0x0369, 0x036a, + 0x036b, 0x036c, 0x036d, 0x036d, 0x036f, 0x036f, 0x0370, 0x0370, + 0x0376, 0x0376, 0x0376, 0x0376, 0x0376, 0x0376, 0x037c, 0x037c, + 0x037c, 0x037c, 0x037c, 0x037c, 0x037c, 0x037c, 0x0394, 0x0394, + 0x0394, 0x0394, 0x0397, 0x0398, 0x0398, 0x0398, 0x0399, 0x0399, + 0x039c, 0x039c, 0x039d, 0x039f, 0x03a2, 0x03a4, 0x03a4, 0x03a5, + 0x03a6, 0x03a6, 0x03a8, 0x03a8, 0x03aa, 0x03aa, 0x03ab, 0x03ac, + 0x03ac, 0x03ac, 0x03ae, 0x03ae, 0x03ae, 0x03ae, 0x03b1, 0x03b1, + // Entry 2C0 - 2FF + 0x03b6, 0x03b6, 0x03b6, 0x03b6, 0x03b8, 0x03b8, 0x03b8, 0x03b8, + 0x03b8, 0x03b8, 0x03ba, 0x03ba, 0x03cd, 0x03cd, 0x03d0, 0x03d1, + 0x03d1, 0x03d2, 0x03d3, 0x03d3, 0x03d5, 0x03d5, 0x03d5, 0x03d5, + 0x03d6, 0x03d7, 0x03d7, 0x03d7, 0x03d7, 0x03d7, 0x03d9, 0x03d9, + 0x03d9, 0x03d9, 0x03da, 0x03da, 0x03da, 0x03dc, 0x03dc, 0x03dd, + 0x03dd, 0x03dd, 0x03de, 0x03de, 0x03de, 0x03de, 0x03de, 0x03de, + 0x03df, 0x03df, 0x03df, 0x03e2, 0x03e5, 0x03e5, 0x03e5, 0x03e5, + 0x03e5, 0x03e5, 0x03e9, 0x03e9, 0x03e9, 0x03ea, 0x03ec, 0x03ee, + // Entry 300 - 33F + 0x03f2, 0x03f4, 0x03f5, 0x03f5, 0x03f7, 0x03f7, 0x03f7, 0x03f7, +} // Size: 1576 bytes + +var normalSymIndex = []curToIndex{ // 1015 elements + 0: {cur: 0x13, idx: 0x6}, + 1: {cur: 0x2e, idx: 0x13}, + 2: {cur: 0x3a, idx: 0x1c}, + 3: {cur: 0x44, idx: 0x20}, + 4: {cur: 0x5e, idx: 0x3b}, + 5: {cur: 0x63, idx: 0x3f}, + 6: {cur: 0x72, idx: 0x4b}, + 7: {cur: 0x7c, idx: 0x5a}, + 8: {cur: 0x7d, idx: 0x5e}, + 9: {cur: 0x85, idx: 0x62}, + 10: {cur: 0x8d, idx: 0x6e}, + 11: {cur: 0xb2, idx: 0x90}, + 12: {cur: 0xc0, idx: 0x9e}, + 13: {cur: 0xf6, idx: 0xc7}, + 14: {cur: 0xfc, idx: 0xcf}, + 15: {cur: 0x105, idx: 0xd3}, + 16: {cur: 0x109, idx: 0xd7}, + 17: {cur: 0x110, idx: 0xdc}, + 18: {cur: 0x115, idx: 0xe0}, + 19: {cur: 0x117, idx: 0xe4}, + 20: {cur: 0xb2, idx: 0x0}, + 21: {cur: 0xeb, idx: 0xbc}, + 22: {cur: 0x125, idx: 0xe9}, + 23: {cur: 0xb9, idx: 0x4}, + 24: {cur: 0x67, idx: 0xf2}, + 25: {cur: 0x13, idx: 0xf8}, + 26: {cur: 0x42, idx: 0xfc}, + 27: {cur: 0x5d, idx: 0x113}, + 28: {cur: 0xeb, idx: 0xbc}, + 29: {cur: 0x0, idx: 0x11a}, + 30: {cur: 0x2, idx: 0x11e}, + 31: {cur: 0x13, idx: 0xf8}, + 32: {cur: 0x23, idx: 0x130}, + 33: {cur: 0x54, idx: 0x15a}, + 34: {cur: 0x58, idx: 0x164}, + 35: {cur: 0x7e, idx: 0x17b}, + 36: {cur: 0x7f, idx: 0x185}, + 37: {cur: 0x84, idx: 0x190}, + 38: {cur: 0x8e, idx: 0x19a}, + 39: {cur: 0x92, idx: 0x1a8}, + 40: {cur: 0x9d, idx: 0x1b2}, + 41: {cur: 0x9e, idx: 0x1bc}, + 42: {cur: 0xab, idx: 0x1c6}, + 43: {cur: 0xc1, idx: 0x1d0}, + 44: {cur: 0xcd, idx: 0x1da}, + 45: {cur: 0xd5, idx: 0x1e4}, + 46: {cur: 0xd8, idx: 0x1f2}, + 47: {cur: 0xd9, idx: 0x1fc}, + 48: {cur: 0xe9, idx: 0x207}, + 49: {cur: 0xeb, idx: 0xbc}, + 50: {cur: 0xf0, idx: 0x211}, + 51: {cur: 0x11f, idx: 0x223}, + 52: {cur: 0x51, idx: 0x22d}, + 53: {cur: 0x59, idx: 0x231}, + 54: {cur: 0x89, idx: 0x6b}, + 55: {cur: 0xd9, idx: 0x0}, + 56: {cur: 0xe1, idx: 0x235}, + 57: {cur: 0x63, idx: 0x237}, + 58: {cur: 0xe4, idx: 0x3f}, + 59: {cur: 0xf7, idx: 0x23c}, + 60: {cur: 0x85, idx: 0x25}, + 61: {cur: 0xeb, idx: 0xbc}, + 62: {cur: 0xfc, idx: 0x4}, + 63: {cur: 0x16, idx: 0x240}, + 64: {cur: 0xeb, idx: 0xbc}, + 65: {cur: 0x16, idx: 0x240}, + 66: {cur: 0x2e, idx: 0x0}, + 67: {cur: 0x37, idx: 0x258}, + 68: {cur: 0x3a, idx: 0x0}, + 69: {cur: 0x85, idx: 0x25}, + 70: {cur: 0xc0, idx: 0x0}, + 71: {cur: 0xd2, idx: 0xb2}, + 72: {cur: 0xfc, idx: 0x4}, + 73: {cur: 0x127, idx: 0x8a}, + 74: {cur: 0xf7, idx: 0x23c}, + 75: {cur: 0x13, idx: 0x0}, + 76: {cur: 0x21, idx: 0x294}, + 77: {cur: 0x2e, idx: 0x0}, + 78: {cur: 0x3a, idx: 0x0}, + 79: {cur: 0x44, idx: 0x0}, + 80: {cur: 0x63, idx: 0x0}, + 81: {cur: 0x72, idx: 0x0}, + 82: {cur: 0x7c, idx: 0x0}, + 83: {cur: 0x7d, idx: 0x0}, + 84: {cur: 0x85, idx: 0x0}, + 85: {cur: 0x8d, idx: 0x0}, + 86: {cur: 0xb2, idx: 0x0}, + 87: {cur: 0xc0, idx: 0x0}, + 88: {cur: 0xf6, idx: 0x0}, + 89: {cur: 0xfc, idx: 0x29a}, + 90: {cur: 0x105, idx: 0x0}, + 91: {cur: 0x110, idx: 0x0}, + 92: {cur: 0x1b, idx: 0xc}, + 93: {cur: 0xeb, idx: 0xbc}, + 94: {cur: 0x44, idx: 0x25}, + 95: {cur: 0x44, idx: 0x20}, + 96: {cur: 0x13, idx: 0x2a1}, + 97: {cur: 0x2e, idx: 0x0}, + 98: {cur: 0x3a, idx: 0x2a4}, + 99: {cur: 0x44, idx: 0x0}, + 100: {cur: 0x63, idx: 0x2ad}, + 101: {cur: 0x72, idx: 0x2b3}, + 102: {cur: 0x7c, idx: 0x0}, + 103: {cur: 0x85, idx: 0x0}, + 104: {cur: 0x8d, idx: 0x0}, + 105: {cur: 0xc0, idx: 0x2bc}, + 106: {cur: 0xf6, idx: 0x0}, + 107: {cur: 0xfc, idx: 0x2c5}, + 108: {cur: 0x105, idx: 0x0}, + 109: {cur: 0x110, idx: 0x0}, + 110: {cur: 0x13, idx: 0x0}, + 111: {cur: 0x18, idx: 0x9}, + 112: {cur: 0x2e, idx: 0x0}, + 113: {cur: 0x3a, idx: 0x0}, + 114: {cur: 0x44, idx: 0x0}, + 115: {cur: 0x63, idx: 0x0}, + 116: {cur: 0x72, idx: 0x0}, + 117: {cur: 0x75, idx: 0x51}, + 118: {cur: 0x7c, idx: 0x0}, + 119: {cur: 0x85, idx: 0x25}, + 120: {cur: 0xb2, idx: 0x0}, + 121: {cur: 0xc0, idx: 0x0}, + 122: {cur: 0xd1, idx: 0x2ca}, + 123: {cur: 0xeb, idx: 0xbc}, + 124: {cur: 0xfc, idx: 0x0}, + 125: {cur: 0x110, idx: 0x0}, + 126: {cur: 0x117, idx: 0x0}, + 127: {cur: 0x18, idx: 0x2cf}, + 128: {cur: 0x4e, idx: 0x2d4}, + 129: {cur: 0x85, idx: 0x25}, + 130: {cur: 0xc9, idx: 0x2d9}, + 131: {cur: 0xd1, idx: 0x2de}, + 132: {cur: 0xf4, idx: 0x2e6}, + 133: {cur: 0x13, idx: 0xf8}, + 134: {cur: 0x2e, idx: 0x0}, + 135: {cur: 0x3a, idx: 0x0}, + 136: {cur: 0x44, idx: 0x25}, + 137: {cur: 0x5c, idx: 0x37}, + 138: {cur: 0xb2, idx: 0x0}, + 139: {cur: 0xeb, idx: 0xbc}, + 140: {cur: 0xfc, idx: 0x0}, + 141: {cur: 0x110, idx: 0x0}, + 142: {cur: 0x62, idx: 0x2eb}, + 143: {cur: 0x1b, idx: 0xc}, + 144: {cur: 0xeb, idx: 0xbc}, + 145: {cur: 0xd2, idx: 0xb2}, + 146: {cur: 0xfb, idx: 0x2f4}, + 147: {cur: 0xfc, idx: 0x4}, + 148: {cur: 0x7e, idx: 0x17b}, + 149: {cur: 0x13, idx: 0xf8}, + 150: {cur: 0x49, idx: 0x2f8}, + 151: {cur: 0x4e, idx: 0x2c}, + 152: {cur: 0x7c, idx: 0x0}, + 153: {cur: 0x7d, idx: 0x0}, + 154: {cur: 0x105, idx: 0x0}, + 155: {cur: 0x112, idx: 0x2fd}, + 156: {cur: 0xd2, idx: 0xb2}, + 157: {cur: 0x8d, idx: 0x0}, + 158: {cur: 0xeb, idx: 0xbc}, + 159: {cur: 0x13, idx: 0xf8}, + 160: {cur: 0x52, idx: 0x304}, + 161: {cur: 0xeb, idx: 0xbc}, + 162: {cur: 0xfc, idx: 0x4}, + 163: {cur: 0x86, idx: 0x308}, + 164: {cur: 0x12, idx: 0x30c}, + 165: {cur: 0x13, idx: 0xf8}, + 166: {cur: 0x20, idx: 0x310}, + 167: {cur: 0x22, idx: 0x314}, + 168: {cur: 0x50, idx: 0x31d}, + 169: {cur: 0x85, idx: 0x25}, + 170: {cur: 0xeb, idx: 0xbc}, + 171: {cur: 0xfc, idx: 0x4}, + 172: {cur: 0x5e, idx: 0x0}, + 173: {cur: 0x5e, idx: 0x0}, + 174: {cur: 0x99, idx: 0x2eb}, + 175: {cur: 0x13, idx: 0x0}, + 176: {cur: 0x85, idx: 0x25}, + 177: {cur: 0xc9, idx: 0xa6}, + 178: {cur: 0xeb, idx: 0xbc}, + 179: {cur: 0xfc, idx: 0x4}, + 180: {cur: 0x13, idx: 0xf8}, + 181: {cur: 0x33, idx: 0x332}, + 182: {cur: 0x7c, idx: 0x0}, + 183: {cur: 0x8d, idx: 0x336}, + 184: {cur: 0xeb, idx: 0x33c}, + 185: {cur: 0x109, idx: 0x0}, + 186: {cur: 0x86, idx: 0x308}, + 187: {cur: 0x13, idx: 0xf8}, + 188: {cur: 0x67, idx: 0xf2}, + 189: {cur: 0xeb, idx: 0xbc}, + 190: {cur: 0x6d, idx: 0x342}, + 191: {cur: 0xeb, idx: 0xbc}, + 192: {cur: 0xfc, idx: 0x4}, + 193: {cur: 0x85, idx: 0x25}, + 194: {cur: 0xfc, idx: 0x4}, + 195: {cur: 0x85, idx: 0x62}, + 196: {cur: 0xfc, idx: 0xcf}, + 197: {cur: 0x110, idx: 0x4}, + 198: {cur: 0x110, idx: 0x4}, + 199: {cur: 0x13, idx: 0x4}, + 200: {cur: 0x2e, idx: 0x0}, + 201: {cur: 0x3a, idx: 0x0}, + 202: {cur: 0x44, idx: 0x0}, + 203: {cur: 0x5e, idx: 0x0}, + 204: {cur: 0x63, idx: 0x0}, + 205: {cur: 0x72, idx: 0x0}, + 206: {cur: 0x7c, idx: 0x0}, + 207: {cur: 0x7d, idx: 0x0}, + 208: {cur: 0x85, idx: 0x0}, + 209: {cur: 0x8d, idx: 0x0}, + 210: {cur: 0xb2, idx: 0x0}, + 211: {cur: 0xc0, idx: 0x0}, + 212: {cur: 0xd7, idx: 0x7e}, + 213: {cur: 0xf6, idx: 0x0}, + 214: {cur: 0xfc, idx: 0x0}, + 215: {cur: 0x105, idx: 0x0}, + 216: {cur: 0x109, idx: 0x0}, + 217: {cur: 0x110, idx: 0x0}, + 218: {cur: 0x115, idx: 0x0}, + 219: {cur: 0x117, idx: 0x355}, + 220: {cur: 0x1a, idx: 0x4}, + 221: {cur: 0x24, idx: 0x359}, + 222: {cur: 0x25, idx: 0x4}, + 223: {cur: 0x32, idx: 0x4}, + 224: {cur: 0x35, idx: 0x16}, + 225: {cur: 0x39, idx: 0x4}, + 226: {cur: 0x3a, idx: 0x4}, + 227: {cur: 0x13, idx: 0x4}, + 228: {cur: 0xc0, idx: 0x4}, + 229: {cur: 0x13, idx: 0x4}, + 230: {cur: 0x52, idx: 0x304}, + 231: {cur: 0x110, idx: 0x4}, + 232: {cur: 0x59, idx: 0x231}, + 233: {cur: 0x60, idx: 0x4}, + 234: {cur: 0x61, idx: 0x3f}, + 235: {cur: 0x63, idx: 0x237}, + 236: {cur: 0x110, idx: 0x4}, + 237: {cur: 0x67, idx: 0xf2}, + 238: {cur: 0x63, idx: 0x237}, + 239: {cur: 0x68, idx: 0x3f}, + 240: {cur: 0x69, idx: 0x35d}, + 241: {cur: 0x71, idx: 0x4}, + 242: {cur: 0x83, idx: 0x4}, + 243: {cur: 0x86, idx: 0x308}, + 244: {cur: 0x13, idx: 0x4}, + 245: {cur: 0x110, idx: 0x4}, + 246: {cur: 0x8f, idx: 0x4}, + 247: {cur: 0x110, idx: 0x4}, + 248: {cur: 0x94, idx: 0x4}, + 249: {cur: 0x125, idx: 0xe9}, + 250: {cur: 0xa3, idx: 0x87}, + 251: {cur: 0xaa, idx: 0x35f}, + 252: {cur: 0x110, idx: 0x4}, + 253: {cur: 0x63, idx: 0x237}, + 254: {cur: 0xae, idx: 0x7e}, + 255: {cur: 0xb1, idx: 0x364}, + 256: {cur: 0xb5, idx: 0x94}, + 257: {cur: 0xb9, idx: 0x4}, + 258: {cur: 0x13, idx: 0x4}, + 259: {cur: 0xba, idx: 0x97}, + 260: {cur: 0x13, idx: 0x4}, + 261: {cur: 0xc0, idx: 0x4}, + 262: {cur: 0xc0, idx: 0x4}, + 263: {cur: 0xc6, idx: 0x8a}, + 264: {cur: 0xc7, idx: 0xa2}, + 265: {cur: 0xc8, idx: 0x7e}, + 266: {cur: 0xc0, idx: 0x4}, + 267: {cur: 0xd4, idx: 0xb6}, + 268: {cur: 0xd6, idx: 0x4}, + 269: {cur: 0xd7, idx: 0x367}, + 270: {cur: 0xdb, idx: 0x30}, + 271: {cur: 0xdc, idx: 0x4}, + 272: {cur: 0x63, idx: 0x237}, + 273: {cur: 0xdd, idx: 0x3f}, + 274: {cur: 0xe0, idx: 0x36a}, + 275: {cur: 0x63, idx: 0x237}, + 276: {cur: 0xe4, idx: 0x3f}, + 277: {cur: 0x8, idx: 0x36d}, + 278: {cur: 0xea, idx: 0x372}, + 279: {cur: 0xc0, idx: 0x4}, + 280: {cur: 0xf1, idx: 0xc0}, + 281: {cur: 0xf5, idx: 0x4}, + 282: {cur: 0x13, idx: 0x4}, + 283: {cur: 0xf7, idx: 0x23c}, + 284: {cur: 0xfb, idx: 0x2f4}, + 285: {cur: 0x110, idx: 0x4}, + 286: {cur: 0x107, idx: 0x374}, + 287: {cur: 0x108, idx: 0x377}, + 288: {cur: 0x125, idx: 0xe9}, + 289: {cur: 0x127, idx: 0x8a}, + 290: {cur: 0x13, idx: 0x0}, + 291: {cur: 0x2e, idx: 0x0}, + 292: {cur: 0x44, idx: 0x0}, + 293: {cur: 0x5c, idx: 0x37}, + 294: {cur: 0x63, idx: 0x0}, + 295: {cur: 0x72, idx: 0x0}, + 296: {cur: 0x7c, idx: 0x0}, + 297: {cur: 0x7d, idx: 0x0}, + 298: {cur: 0x85, idx: 0x0}, + 299: {cur: 0x8d, idx: 0x0}, + 300: {cur: 0xb2, idx: 0x0}, + 301: {cur: 0xc0, idx: 0x0}, + 302: {cur: 0xeb, idx: 0xbc}, + 303: {cur: 0xf6, idx: 0x0}, + 304: {cur: 0x109, idx: 0x0}, + 305: {cur: 0x110, idx: 0x0}, + 306: {cur: 0x115, idx: 0x0}, + 307: {cur: 0x3a, idx: 0x0}, + 308: {cur: 0x5e, idx: 0x0}, + 309: {cur: 0xeb, idx: 0x0}, + 310: {cur: 0xfc, idx: 0x0}, + 311: {cur: 0x105, idx: 0x0}, + 312: {cur: 0x11, idx: 0x4}, + 313: {cur: 0xfc, idx: 0xcf}, + 314: {cur: 0x27, idx: 0x10}, + 315: {cur: 0x2e, idx: 0x13}, + 316: {cur: 0x39, idx: 0x4}, + 317: {cur: 0x41, idx: 0x4}, + 318: {cur: 0xfc, idx: 0xcf}, + 319: {cur: 0x45, idx: 0x4}, + 320: {cur: 0xfc, idx: 0xcf}, + 321: {cur: 0x47, idx: 0x28}, + 322: {cur: 0x4b, idx: 0x4}, + 323: {cur: 0xfc, idx: 0xcf}, + 324: {cur: 0x53, idx: 0x264}, + 325: {cur: 0xfc, idx: 0xcf}, + 326: {cur: 0xfc, idx: 0x4}, + 327: {cur: 0x109, idx: 0xd7}, + 328: {cur: 0x6e, idx: 0x49}, + 329: {cur: 0x73, idx: 0x4f}, + 330: {cur: 0xb2, idx: 0x4}, + 331: {cur: 0xbc, idx: 0x9b}, + 332: {cur: 0xc2, idx: 0x387}, + 333: {cur: 0xc4, idx: 0x38b}, + 334: {cur: 0xc7, idx: 0xa2}, + 335: {cur: 0xfc, idx: 0x4}, + 336: {cur: 0xcc, idx: 0x38e}, + 337: {cur: 0xfc, idx: 0x4}, + 338: {cur: 0x85, idx: 0x25}, + 339: {cur: 0xfc, idx: 0x4}, + 340: {cur: 0xfc, idx: 0xcf}, + 341: {cur: 0x101, idx: 0x4}, + 342: {cur: 0x104, idx: 0x392}, + 343: {cur: 0x13, idx: 0xf8}, + 344: {cur: 0x57, idx: 0x30}, + 345: {cur: 0x85, idx: 0x25}, + 346: {cur: 0xeb, idx: 0xbc}, + 347: {cur: 0xfc, idx: 0x4}, + 348: {cur: 0x5c, idx: 0x37}, + 349: {cur: 0xeb, idx: 0xbc}, + 350: {cur: 0x4, idx: 0x396}, + 351: {cur: 0x3a, idx: 0x2a4}, + 352: {cur: 0x44, idx: 0x399}, + 353: {cur: 0x72, idx: 0x39e}, + 354: {cur: 0x7f, idx: 0x3a2}, + 355: {cur: 0x85, idx: 0x25}, + 356: {cur: 0xb2, idx: 0x3ab}, + 357: {cur: 0xc0, idx: 0x3af}, + 358: {cur: 0xeb, idx: 0xbc}, + 359: {cur: 0xfc, idx: 0x4}, + 360: {cur: 0x110, idx: 0x3b3}, + 361: {cur: 0x6a, idx: 0x46}, + 362: {cur: 0xab, idx: 0x3b7}, + 363: {cur: 0x13, idx: 0x0}, + 364: {cur: 0x2e, idx: 0x0}, + 365: {cur: 0x3a, idx: 0x0}, + 366: {cur: 0x44, idx: 0x0}, + 367: {cur: 0x5f, idx: 0x3ba}, + 368: {cur: 0x72, idx: 0x0}, + 369: {cur: 0x7c, idx: 0x0}, + 370: {cur: 0x7d, idx: 0x0}, + 371: {cur: 0x85, idx: 0x25}, + 372: {cur: 0x8d, idx: 0x0}, + 373: {cur: 0xb2, idx: 0x0}, + 374: {cur: 0xc0, idx: 0x0}, + 375: {cur: 0xf6, idx: 0x0}, + 376: {cur: 0xfc, idx: 0x4}, + 377: {cur: 0x105, idx: 0x0}, + 378: {cur: 0x110, idx: 0x0}, + 379: {cur: 0x117, idx: 0x0}, + 380: {cur: 0x85, idx: 0x25}, + 381: {cur: 0xc7, idx: 0xa2}, + 382: {cur: 0xeb, idx: 0xbc}, + 383: {cur: 0xfc, idx: 0x4}, + 384: {cur: 0x52, idx: 0x30}, + 385: {cur: 0x52, idx: 0x304}, + 386: {cur: 0x11, idx: 0x3bd}, + 387: {cur: 0x13, idx: 0x3c1}, + 388: {cur: 0x1d, idx: 0x3c5}, + 389: {cur: 0x25, idx: 0x3c8}, + 390: {cur: 0x26, idx: 0x3cc}, + 391: {cur: 0x32, idx: 0x3d0}, + 392: {cur: 0x39, idx: 0x3d4}, + 393: {cur: 0x3a, idx: 0x2a4}, + 394: {cur: 0x41, idx: 0x3d8}, + 395: {cur: 0x44, idx: 0x0}, + 396: {cur: 0x45, idx: 0x3dc}, + 397: {cur: 0x4d, idx: 0x3e0}, + 398: {cur: 0x60, idx: 0x3e9}, + 399: {cur: 0x61, idx: 0x3ed}, + 400: {cur: 0x62, idx: 0x2eb}, + 401: {cur: 0x63, idx: 0x3f2}, + 402: {cur: 0x68, idx: 0x3f7}, + 403: {cur: 0x72, idx: 0x0}, + 404: {cur: 0x79, idx: 0x3fc}, + 405: {cur: 0x7a, idx: 0x401}, + 406: {cur: 0x82, idx: 0x406}, + 407: {cur: 0x85, idx: 0x0}, + 408: {cur: 0x92, idx: 0x40c}, + 409: {cur: 0xad, idx: 0x411}, + 410: {cur: 0xb2, idx: 0x3ab}, + 411: {cur: 0xb9, idx: 0x416}, + 412: {cur: 0xc0, idx: 0x3af}, + 413: {cur: 0xce, idx: 0x41d}, + 414: {cur: 0xd6, idx: 0x424}, + 415: {cur: 0xdc, idx: 0x428}, + 416: {cur: 0xe2, idx: 0x42c}, + 417: {cur: 0xf5, idx: 0x430}, + 418: {cur: 0xf6, idx: 0x0}, + 419: {cur: 0xfc, idx: 0x434}, + 420: {cur: 0x101, idx: 0x438}, + 421: {cur: 0x108, idx: 0x377}, + 422: {cur: 0x110, idx: 0x0}, + 423: {cur: 0x117, idx: 0x43c}, + 424: {cur: 0x24, idx: 0x359}, + 425: {cur: 0x11, idx: 0x0}, + 426: {cur: 0x13, idx: 0x444}, + 427: {cur: 0x25, idx: 0x0}, + 428: {cur: 0x26, idx: 0x0}, + 429: {cur: 0x32, idx: 0x0}, + 430: {cur: 0x39, idx: 0x0}, + 431: {cur: 0x3a, idx: 0x4}, + 432: {cur: 0x41, idx: 0x0}, + 433: {cur: 0x44, idx: 0x20}, + 434: {cur: 0x45, idx: 0x0}, + 435: {cur: 0x60, idx: 0x0}, + 436: {cur: 0x61, idx: 0x0}, + 437: {cur: 0x63, idx: 0x3f}, + 438: {cur: 0x68, idx: 0x0}, + 439: {cur: 0x72, idx: 0x44a}, + 440: {cur: 0x7c, idx: 0x0}, + 441: {cur: 0x7d, idx: 0x0}, + 442: {cur: 0x85, idx: 0x25}, + 443: {cur: 0x8d, idx: 0x0}, + 444: {cur: 0x92, idx: 0x0}, + 445: {cur: 0xb2, idx: 0x0}, + 446: {cur: 0xb9, idx: 0x0}, + 447: {cur: 0xc0, idx: 0x450}, + 448: {cur: 0xd6, idx: 0x0}, + 449: {cur: 0xdc, idx: 0x456}, + 450: {cur: 0xe2, idx: 0x0}, + 451: {cur: 0xf5, idx: 0x0}, + 452: {cur: 0xfc, idx: 0x45c}, + 453: {cur: 0x101, idx: 0x0}, + 454: {cur: 0x105, idx: 0x0}, + 455: {cur: 0x109, idx: 0x0}, + 456: {cur: 0x115, idx: 0x0}, + 457: {cur: 0x117, idx: 0x0}, + 458: {cur: 0x3b, idx: 0x32a}, + 459: {cur: 0x51, idx: 0x22d}, + 460: {cur: 0x54, idx: 0x462}, + 461: {cur: 0x6a, idx: 0x46}, + 462: {cur: 0x76, idx: 0x465}, + 463: {cur: 0x89, idx: 0x6b}, + 464: {cur: 0x62, idx: 0x0}, + 465: {cur: 0x99, idx: 0x2eb}, + 466: {cur: 0xa3, idx: 0x87}, + 467: {cur: 0xab, idx: 0x3b7}, + 468: {cur: 0xae, idx: 0x7e}, + 469: {cur: 0xd4, idx: 0xb6}, + 470: {cur: 0xd7, idx: 0x367}, + 471: {cur: 0xe9, idx: 0x467}, + 472: {cur: 0xf0, idx: 0x46a}, + 473: {cur: 0x107, idx: 0x374}, + 474: {cur: 0x13, idx: 0xf8}, + 475: {cur: 0x3a, idx: 0x9b}, + 476: {cur: 0x60, idx: 0x16e}, + 477: {cur: 0xd6, idx: 0x28a}, + 478: {cur: 0xeb, idx: 0xbc}, + 479: {cur: 0x117, idx: 0x0}, + 480: {cur: 0x85, idx: 0x25}, + 481: {cur: 0xeb, idx: 0xbc}, + 482: {cur: 0xfc, idx: 0x4}, + 483: {cur: 0xeb, idx: 0xbc}, + 484: {cur: 0xfc, idx: 0x4}, + 485: {cur: 0x5c, idx: 0x37}, + 486: {cur: 0xb2, idx: 0x3ab}, + 487: {cur: 0xeb, idx: 0xbc}, + 488: {cur: 0xfc, idx: 0x4}, + 489: {cur: 0x12, idx: 0x30c}, + 490: {cur: 0x85, idx: 0x25}, + 491: {cur: 0xfc, idx: 0x4}, + 492: {cur: 0xeb, idx: 0xbc}, + 493: {cur: 0x86, idx: 0x308}, + 494: {cur: 0xba, idx: 0x97}, + 495: {cur: 0x67, idx: 0xf2}, + 496: {cur: 0xfc, idx: 0x4}, + 497: {cur: 0x44, idx: 0x47c}, + 498: {cur: 0x7a, idx: 0x487}, + 499: {cur: 0x85, idx: 0x25}, + 500: {cur: 0xeb, idx: 0xbc}, + 501: {cur: 0xfc, idx: 0x4}, + 502: {cur: 0xeb, idx: 0xbc}, + 503: {cur: 0xfc, idx: 0x4}, + 504: {cur: 0x13, idx: 0x0}, + 505: {cur: 0x2e, idx: 0x0}, + 506: {cur: 0x3a, idx: 0x0}, + 507: {cur: 0x44, idx: 0x0}, + 508: {cur: 0x5e, idx: 0x0}, + 509: {cur: 0x63, idx: 0x0}, + 510: {cur: 0x72, idx: 0x0}, + 511: {cur: 0x7c, idx: 0x0}, + 512: {cur: 0x7d, idx: 0x0}, + 513: {cur: 0x85, idx: 0x0}, + 514: {cur: 0x8d, idx: 0x0}, + 515: {cur: 0xb2, idx: 0x0}, + 516: {cur: 0xc0, idx: 0x0}, + 517: {cur: 0xf6, idx: 0x0}, + 518: {cur: 0xfc, idx: 0x0}, + 519: {cur: 0x105, idx: 0x0}, + 520: {cur: 0x110, idx: 0x0}, + 521: {cur: 0x117, idx: 0x0}, + 522: {cur: 0x18, idx: 0x9}, + 523: {cur: 0x13, idx: 0x0}, + 524: {cur: 0x85, idx: 0x25}, + 525: {cur: 0xc9, idx: 0xa6}, + 526: {cur: 0xeb, idx: 0xbc}, + 527: {cur: 0xfc, idx: 0x4}, + 528: {cur: 0x13, idx: 0x0}, + 529: {cur: 0x2e, idx: 0x0}, + 530: {cur: 0x3a, idx: 0x0}, + 531: {cur: 0x44, idx: 0x0}, + 532: {cur: 0x5e, idx: 0x0}, + 533: {cur: 0x63, idx: 0x0}, + 534: {cur: 0x72, idx: 0x0}, + 535: {cur: 0x77, idx: 0x54}, + 536: {cur: 0x7c, idx: 0x0}, + 537: {cur: 0x7d, idx: 0x0}, + 538: {cur: 0x85, idx: 0x25}, + 539: {cur: 0x8d, idx: 0x0}, + 540: {cur: 0xb2, idx: 0x0}, + 541: {cur: 0xc0, idx: 0x0}, + 542: {cur: 0xf6, idx: 0x0}, + 543: {cur: 0xfc, idx: 0x0}, + 544: {cur: 0x105, idx: 0x0}, + 545: {cur: 0x110, idx: 0x0}, + 546: {cur: 0x7, idx: 0x498}, + 547: {cur: 0xeb, idx: 0xbc}, + 548: {cur: 0xfc, idx: 0x4}, + 549: {cur: 0x13, idx: 0xf8}, + 550: {cur: 0x78, idx: 0x57}, + 551: {cur: 0x7d, idx: 0x7e}, + 552: {cur: 0xeb, idx: 0xbc}, + 553: {cur: 0xba, idx: 0x97}, + 554: {cur: 0x44, idx: 0x25}, + 555: {cur: 0x13, idx: 0x0}, + 556: {cur: 0x2e, idx: 0x0}, + 557: {cur: 0x3a, idx: 0x0}, + 558: {cur: 0x5e, idx: 0x0}, + 559: {cur: 0x63, idx: 0x0}, + 560: {cur: 0x7d, idx: 0x0}, + 561: {cur: 0x8d, idx: 0x0}, + 562: {cur: 0xb2, idx: 0x0}, + 563: {cur: 0xc0, idx: 0x0}, + 564: {cur: 0xf6, idx: 0x0}, + 565: {cur: 0xfc, idx: 0x0}, + 566: {cur: 0x105, idx: 0x0}, + 567: {cur: 0x2e, idx: 0x0}, + 568: {cur: 0x72, idx: 0x0}, + 569: {cur: 0x85, idx: 0x0}, + 570: {cur: 0x8d, idx: 0x0}, + 571: {cur: 0xb2, idx: 0x0}, + 572: {cur: 0xeb, idx: 0xbc}, + 573: {cur: 0xf6, idx: 0x0}, + 574: {cur: 0xfc, idx: 0x0}, + 575: {cur: 0x44, idx: 0x49f}, + 576: {cur: 0x85, idx: 0x4a3}, + 577: {cur: 0xfc, idx: 0x4}, + 578: {cur: 0xf7, idx: 0x23c}, + 579: {cur: 0x13, idx: 0x0}, + 580: {cur: 0x44, idx: 0x0}, + 581: {cur: 0x65, idx: 0x42}, + 582: {cur: 0x72, idx: 0x0}, + 583: {cur: 0x7c, idx: 0x0}, + 584: {cur: 0x7d, idx: 0x0}, + 585: {cur: 0x85, idx: 0x0}, + 586: {cur: 0x8d, idx: 0x0}, + 587: {cur: 0xc0, idx: 0x0}, + 588: {cur: 0x105, idx: 0x0}, + 589: {cur: 0x54, idx: 0x462}, + 590: {cur: 0x86, idx: 0x308}, + 591: {cur: 0xf7, idx: 0x23c}, + 592: {cur: 0x13, idx: 0xf8}, + 593: {cur: 0x4c, idx: 0x4ae}, + 594: {cur: 0xeb, idx: 0xbc}, + 595: {cur: 0x86, idx: 0x308}, + 596: {cur: 0x90, idx: 0x72}, + 597: {cur: 0xd2, idx: 0xb2}, + 598: {cur: 0xeb, idx: 0xbc}, + 599: {cur: 0xfc, idx: 0x4}, + 600: {cur: 0x52, idx: 0x304}, + 601: {cur: 0x86, idx: 0x308}, + 602: {cur: 0x88, idx: 0x67}, + 603: {cur: 0xeb, idx: 0xbc}, + 604: {cur: 0xfc, idx: 0x4}, + 605: {cur: 0xeb, idx: 0xbc}, + 606: {cur: 0xfc, idx: 0x4}, + 607: {cur: 0x13, idx: 0xf8}, + 608: {cur: 0xf7, idx: 0x23c}, + 609: {cur: 0x13, idx: 0x0}, + 610: {cur: 0x2e, idx: 0x0}, + 611: {cur: 0x3a, idx: 0x0}, + 612: {cur: 0x63, idx: 0x0}, + 613: {cur: 0x72, idx: 0x0}, + 614: {cur: 0x7c, idx: 0x0}, + 615: {cur: 0x7d, idx: 0x0}, + 616: {cur: 0x87, idx: 0x4bf}, + 617: {cur: 0x8d, idx: 0x0}, + 618: {cur: 0xb2, idx: 0x0}, + 619: {cur: 0xc0, idx: 0x0}, + 620: {cur: 0xeb, idx: 0xbc}, + 621: {cur: 0xf6, idx: 0x0}, + 622: {cur: 0xfc, idx: 0x0}, + 623: {cur: 0x110, idx: 0x0}, + 624: {cur: 0xf7, idx: 0x23c}, + 625: {cur: 0x12, idx: 0x30c}, + 626: {cur: 0x13, idx: 0xf8}, + 627: {cur: 0x85, idx: 0x25}, + 628: {cur: 0xeb, idx: 0xbc}, + 629: {cur: 0xfc, idx: 0x4}, + 630: {cur: 0xfb, idx: 0x2f4}, + 631: {cur: 0xfc, idx: 0x4}, + 632: {cur: 0x3b, idx: 0x32a}, + 633: {cur: 0x9, idx: 0x1}, + 634: {cur: 0x91, idx: 0x76}, + 635: {cur: 0xeb, idx: 0xbc}, + 636: {cur: 0x7e, idx: 0x17b}, + 637: {cur: 0x13, idx: 0x0}, + 638: {cur: 0x2e, idx: 0x0}, + 639: {cur: 0x3a, idx: 0x0}, + 640: {cur: 0x44, idx: 0x0}, + 641: {cur: 0x63, idx: 0x0}, + 642: {cur: 0x72, idx: 0x0}, + 643: {cur: 0x7c, idx: 0x0}, + 644: {cur: 0x7d, idx: 0x0}, + 645: {cur: 0x85, idx: 0x0}, + 646: {cur: 0x8d, idx: 0x0}, + 647: {cur: 0xb2, idx: 0x0}, + 648: {cur: 0xc0, idx: 0x0}, + 649: {cur: 0xf6, idx: 0x0}, + 650: {cur: 0xfc, idx: 0x0}, + 651: {cur: 0x105, idx: 0x0}, + 652: {cur: 0x109, idx: 0x0}, + 653: {cur: 0x110, idx: 0x0}, + 654: {cur: 0x115, idx: 0x0}, + 655: {cur: 0x117, idx: 0x0}, + 656: {cur: 0x3b, idx: 0x32a}, + 657: {cur: 0x86, idx: 0x308}, + 658: {cur: 0x86, idx: 0x308}, + 659: {cur: 0x13, idx: 0xf8}, + 660: {cur: 0x85, idx: 0x25}, + 661: {cur: 0x9b, idx: 0x84}, + 662: {cur: 0xeb, idx: 0xbc}, + 663: {cur: 0xfc, idx: 0x4}, + 664: {cur: 0x86, idx: 0x308}, + 665: {cur: 0xf7, idx: 0x23c}, + 666: {cur: 0x86, idx: 0x308}, + 667: {cur: 0xae, idx: 0x7e}, + 668: {cur: 0xa3, idx: 0x87}, + 669: {cur: 0xb8, idx: 0x4cc}, + 670: {cur: 0x13, idx: 0x0}, + 671: {cur: 0x44, idx: 0x0}, + 672: {cur: 0x63, idx: 0x0}, + 673: {cur: 0x72, idx: 0x0}, + 674: {cur: 0x7c, idx: 0x0}, + 675: {cur: 0x7d, idx: 0x0}, + 676: {cur: 0x85, idx: 0x0}, + 677: {cur: 0x8d, idx: 0x0}, + 678: {cur: 0xa5, idx: 0x4d0}, + 679: {cur: 0xc0, idx: 0x0}, + 680: {cur: 0xf6, idx: 0x0}, + 681: {cur: 0x105, idx: 0x0}, + 682: {cur: 0x85, idx: 0x25}, + 683: {cur: 0xeb, idx: 0xbc}, + 684: {cur: 0xfc, idx: 0x4}, + 685: {cur: 0xa9, idx: 0x8c}, + 686: {cur: 0xeb, idx: 0xbc}, + 687: {cur: 0xfc, idx: 0x4}, + 688: {cur: 0xeb, idx: 0xbc}, + 689: {cur: 0xfc, idx: 0x4}, + 690: {cur: 0x3a, idx: 0x0}, + 691: {cur: 0xb2, idx: 0x0}, + 692: {cur: 0xb5, idx: 0x94}, + 693: {cur: 0xfc, idx: 0x0}, + 694: {cur: 0x26, idx: 0x4}, + 695: {cur: 0xdc, idx: 0x4}, + 696: {cur: 0x8, idx: 0x4dc}, + 697: {cur: 0x14, idx: 0x4e0}, + 698: {cur: 0x76, idx: 0x465}, + 699: {cur: 0xa8, idx: 0x8a}, + 700: {cur: 0xc2, idx: 0x387}, + 701: {cur: 0xeb, idx: 0xbc}, + 702: {cur: 0xf5, idx: 0x21b}, + 703: {cur: 0xfc, idx: 0x4}, + 704: {cur: 0xb9, idx: 0x4}, + 705: {cur: 0x13, idx: 0x0}, + 706: {cur: 0x2e, idx: 0x0}, + 707: {cur: 0x3a, idx: 0x0}, + 708: {cur: 0x44, idx: 0x0}, + 709: {cur: 0x72, idx: 0x0}, + 710: {cur: 0x7c, idx: 0x0}, + 711: {cur: 0x7d, idx: 0x0}, + 712: {cur: 0x85, idx: 0x0}, + 713: {cur: 0x8d, idx: 0x0}, + 714: {cur: 0xb2, idx: 0x0}, + 715: {cur: 0xbe, idx: 0x30}, + 716: {cur: 0xc0, idx: 0x0}, + 717: {cur: 0xf6, idx: 0x0}, + 718: {cur: 0xfc, idx: 0x0}, + 719: {cur: 0x105, idx: 0x0}, + 720: {cur: 0x109, idx: 0x0}, + 721: {cur: 0x110, idx: 0x0}, + 722: {cur: 0x117, idx: 0x0}, + 723: {cur: 0xbf, idx: 0x4e4}, + 724: {cur: 0xeb, idx: 0xbc}, + 725: {cur: 0x13, idx: 0xf8}, + 726: {cur: 0x3a, idx: 0x9b}, + 727: {cur: 0x60, idx: 0x16e}, + 728: {cur: 0xd6, idx: 0x28a}, + 729: {cur: 0xeb, idx: 0xbc}, + 730: {cur: 0x117, idx: 0x0}, + 731: {cur: 0x14, idx: 0x4f8}, + 732: {cur: 0xfc, idx: 0x4}, + 733: {cur: 0x8, idx: 0x36d}, + 734: {cur: 0xe2, idx: 0x4}, + 735: {cur: 0x8, idx: 0x36d}, + 736: {cur: 0x13, idx: 0x0}, + 737: {cur: 0x2e, idx: 0x0}, + 738: {cur: 0x3a, idx: 0x0}, + 739: {cur: 0x44, idx: 0x0}, + 740: {cur: 0x63, idx: 0x0}, + 741: {cur: 0x72, idx: 0x0}, + 742: {cur: 0x7c, idx: 0x0}, + 743: {cur: 0x7d, idx: 0x0}, + 744: {cur: 0x85, idx: 0x0}, + 745: {cur: 0x8d, idx: 0x0}, + 746: {cur: 0xb2, idx: 0x0}, + 747: {cur: 0xbe, idx: 0x30}, + 748: {cur: 0xc0, idx: 0x0}, + 749: {cur: 0xf6, idx: 0x0}, + 750: {cur: 0xfc, idx: 0x0}, + 751: {cur: 0x105, idx: 0x0}, + 752: {cur: 0x109, idx: 0x0}, + 753: {cur: 0x110, idx: 0x0}, + 754: {cur: 0x117, idx: 0x0}, + 755: {cur: 0x63, idx: 0x237}, + 756: {cur: 0xe4, idx: 0x3f}, + 757: {cur: 0xfb, idx: 0x2f4}, + 758: {cur: 0x5d, idx: 0x258}, + 759: {cur: 0x86, idx: 0x308}, + 760: {cur: 0x85, idx: 0x25}, + 761: {cur: 0xfc, idx: 0x4}, + 762: {cur: 0x65, idx: 0x42}, + 763: {cur: 0xfc, idx: 0x4}, + 764: {cur: 0x65, idx: 0x0}, + 765: {cur: 0xd2, idx: 0xb2}, + 766: {cur: 0xeb, idx: 0xbc}, + 767: {cur: 0xc8, idx: 0x4fd}, + 768: {cur: 0x13, idx: 0x0}, + 769: {cur: 0x3a, idx: 0x0}, + 770: {cur: 0x44, idx: 0x0}, + 771: {cur: 0x63, idx: 0x0}, + 772: {cur: 0x72, idx: 0x0}, + 773: {cur: 0x7c, idx: 0x0}, + 774: {cur: 0x7d, idx: 0x0}, + 775: {cur: 0x85, idx: 0x0}, + 776: {cur: 0x8d, idx: 0x0}, + 777: {cur: 0xb2, idx: 0x0}, + 778: {cur: 0xc0, idx: 0x0}, + 779: {cur: 0xc9, idx: 0xa6}, + 780: {cur: 0xf6, idx: 0x0}, + 781: {cur: 0xfc, idx: 0x0}, + 782: {cur: 0x105, idx: 0x0}, + 783: {cur: 0x4, idx: 0x396}, + 784: {cur: 0x13, idx: 0xf8}, + 785: {cur: 0xcb, idx: 0x504}, + 786: {cur: 0xeb, idx: 0xbc}, + 787: {cur: 0x9, idx: 0x1}, + 788: {cur: 0x4c, idx: 0x4ae}, + 789: {cur: 0xcb, idx: 0x509}, + 790: {cur: 0x99, idx: 0x2eb}, + 791: {cur: 0xaa, idx: 0x35f}, + 792: {cur: 0xb8, idx: 0x4cc}, + 793: {cur: 0xcb, idx: 0x4ae}, + 794: {cur: 0xe5, idx: 0xb9}, + 795: {cur: 0xc4, idx: 0x38b}, + 796: {cur: 0x27, idx: 0x10}, + 797: {cur: 0xc4, idx: 0x0}, + 798: {cur: 0xc4, idx: 0x0}, + 799: {cur: 0xfc, idx: 0x4}, + 800: {cur: 0x24, idx: 0x359}, + 801: {cur: 0x13, idx: 0x0}, + 802: {cur: 0x2e, idx: 0x0}, + 803: {cur: 0x3a, idx: 0x0}, + 804: {cur: 0x44, idx: 0x0}, + 805: {cur: 0x5e, idx: 0x0}, + 806: {cur: 0x63, idx: 0x0}, + 807: {cur: 0x72, idx: 0x0}, + 808: {cur: 0x7c, idx: 0x0}, + 809: {cur: 0x7d, idx: 0x0}, + 810: {cur: 0x85, idx: 0x0}, + 811: {cur: 0x8d, idx: 0x0}, + 812: {cur: 0xb2, idx: 0x0}, + 813: {cur: 0xc0, idx: 0x0}, + 814: {cur: 0xf6, idx: 0x0}, + 815: {cur: 0xfc, idx: 0x0}, + 816: {cur: 0x105, idx: 0x0}, + 817: {cur: 0x110, idx: 0x0}, + 818: {cur: 0xa2, idx: 0x4f}, + 819: {cur: 0xf7, idx: 0x23c}, + 820: {cur: 0x0, idx: 0x510}, + 821: {cur: 0x85, idx: 0x25}, + 822: {cur: 0xd2, idx: 0xb2}, + 823: {cur: 0xd3, idx: 0x18}, + 824: {cur: 0xeb, idx: 0xbc}, + 825: {cur: 0xef, idx: 0x519}, + 826: {cur: 0xf8, idx: 0xcb}, + 827: {cur: 0xfc, idx: 0x4}, + 828: {cur: 0x37, idx: 0x258}, + 829: {cur: 0xd3, idx: 0x0}, + 830: {cur: 0x87, idx: 0x4bf}, + 831: {cur: 0x90, idx: 0x72}, + 832: {cur: 0xa2, idx: 0x4f}, + 833: {cur: 0xd4, idx: 0xb6}, + 834: {cur: 0xf7, idx: 0x23c}, + 835: {cur: 0xd2, idx: 0xb2}, + 836: {cur: 0x86, idx: 0x308}, + 837: {cur: 0xf7, idx: 0x23c}, + 838: {cur: 0xc8, idx: 0x7e}, + 839: {cur: 0x52, idx: 0x520}, + 840: {cur: 0xbe, idx: 0x30}, + 841: {cur: 0xdb, idx: 0x524}, + 842: {cur: 0xeb, idx: 0xbc}, + 843: {cur: 0xbe, idx: 0x528}, + 844: {cur: 0xdb, idx: 0x30}, + 845: {cur: 0xb8, idx: 0x4cc}, + 846: {cur: 0x93, idx: 0x52c}, + 847: {cur: 0xeb, idx: 0xbc}, + 848: {cur: 0x115, idx: 0x534}, + 849: {cur: 0x13, idx: 0x0}, + 850: {cur: 0x2e, idx: 0x0}, + 851: {cur: 0x3a, idx: 0x0}, + 852: {cur: 0x44, idx: 0x0}, + 853: {cur: 0x63, idx: 0x0}, + 854: {cur: 0x72, idx: 0x0}, + 855: {cur: 0x7c, idx: 0x544}, + 856: {cur: 0x7d, idx: 0x0}, + 857: {cur: 0x85, idx: 0x0}, + 858: {cur: 0x8d, idx: 0x0}, + 859: {cur: 0xc0, idx: 0x0}, + 860: {cur: 0xf6, idx: 0x0}, + 861: {cur: 0xfc, idx: 0x0}, + 862: {cur: 0x105, idx: 0x0}, + 863: {cur: 0x13, idx: 0x0}, + 864: {cur: 0x2e, idx: 0x0}, + 865: {cur: 0x3a, idx: 0x0}, + 866: {cur: 0x63, idx: 0x0}, + 867: {cur: 0x85, idx: 0x25}, + 868: {cur: 0xb2, idx: 0x0}, + 869: {cur: 0xc0, idx: 0x0}, + 870: {cur: 0xf6, idx: 0x0}, + 871: {cur: 0xfc, idx: 0x4}, + 872: {cur: 0x110, idx: 0x0}, + 873: {cur: 0xe1, idx: 0x235}, + 874: {cur: 0x51, idx: 0x22d}, + 875: {cur: 0x5d, idx: 0x258}, + 876: {cur: 0x86, idx: 0x308}, + 877: {cur: 0x6, idx: 0x548}, + 878: {cur: 0xeb, idx: 0xbc}, + 879: {cur: 0xa5, idx: 0x54e}, + 880: {cur: 0x13, idx: 0x0}, + 881: {cur: 0x18, idx: 0x2cf}, + 882: {cur: 0x85, idx: 0x25}, + 883: {cur: 0x8d, idx: 0x0}, + 884: {cur: 0xc0, idx: 0x0}, + 885: {cur: 0x105, idx: 0x0}, + 886: {cur: 0x13, idx: 0x0}, + 887: {cur: 0x18, idx: 0x9}, + 888: {cur: 0x85, idx: 0x25}, + 889: {cur: 0x8d, idx: 0x0}, + 890: {cur: 0xc0, idx: 0x0}, + 891: {cur: 0x105, idx: 0x0}, + 892: {cur: 0x13, idx: 0x0}, + 893: {cur: 0x1a, idx: 0x24c}, + 894: {cur: 0x25, idx: 0x13a}, + 895: {cur: 0x2e, idx: 0x555}, + 896: {cur: 0x32, idx: 0x142}, + 897: {cur: 0x39, idx: 0x146}, + 898: {cur: 0x44, idx: 0x0}, + 899: {cur: 0x52, idx: 0x520}, + 900: {cur: 0x53, idx: 0x264}, + 901: {cur: 0x57, idx: 0x559}, + 902: {cur: 0x58, idx: 0x55d}, + 903: {cur: 0x63, idx: 0x0}, + 904: {cur: 0x72, idx: 0x0}, + 905: {cur: 0x79, idx: 0x562}, + 906: {cur: 0x7d, idx: 0x0}, + 907: {cur: 0x81, idx: 0x567}, + 908: {cur: 0x83, idx: 0x18c}, + 909: {cur: 0x85, idx: 0x0}, + 910: {cur: 0x8d, idx: 0x0}, + 911: {cur: 0xbe, idx: 0x528}, + 912: {cur: 0xc0, idx: 0x0}, + 913: {cur: 0xdb, idx: 0x30}, + 914: {cur: 0xf6, idx: 0x0}, + 915: {cur: 0x105, idx: 0x0}, + 916: {cur: 0x86, idx: 0x308}, + 917: {cur: 0xeb, idx: 0xbc}, + 918: {cur: 0xf7, idx: 0x23c}, + 919: {cur: 0x3b, idx: 0x32a}, + 920: {cur: 0xfb, idx: 0x2f4}, + 921: {cur: 0x85, idx: 0x25}, + 922: {cur: 0xeb, idx: 0xbc}, + 923: {cur: 0xfc, idx: 0x4}, + 924: {cur: 0x93, idx: 0x56b}, + 925: {cur: 0xb5, idx: 0x94}, + 926: {cur: 0xdc, idx: 0x28e}, + 927: {cur: 0xb5, idx: 0x94}, + 928: {cur: 0xdc, idx: 0x4}, + 929: {cur: 0xfc, idx: 0xcf}, + 930: {cur: 0xeb, idx: 0xbc}, + 931: {cur: 0xfc, idx: 0x4}, + 932: {cur: 0xfb, idx: 0x2f4}, + 933: {cur: 0x86, idx: 0x308}, + 934: {cur: 0xed, idx: 0x56f}, + 935: {cur: 0xfc, idx: 0x4}, + 936: {cur: 0x13, idx: 0xf8}, + 937: {cur: 0x85, idx: 0x25}, + 938: {cur: 0x5d, idx: 0x258}, + 939: {cur: 0x59, idx: 0x231}, + 940: {cur: 0x5e, idx: 0x0}, + 941: {cur: 0x63, idx: 0x0}, + 942: {cur: 0x13, idx: 0x577}, + 943: {cur: 0xc0, idx: 0x57c}, + 944: {cur: 0xf1, idx: 0xc0}, + 945: {cur: 0x13, idx: 0xf8}, + 946: {cur: 0x85, idx: 0x25}, + 947: {cur: 0xeb, idx: 0xbc}, + 948: {cur: 0xf4, idx: 0xc3}, + 949: {cur: 0xfc, idx: 0x4}, + 950: {cur: 0xd2, idx: 0xb2}, + 951: {cur: 0xfc, idx: 0x4}, + 952: {cur: 0x44, idx: 0x4a3}, + 953: {cur: 0xfc, idx: 0x4}, + 954: {cur: 0x13, idx: 0x0}, + 955: {cur: 0x2e, idx: 0x0}, + 956: {cur: 0x3a, idx: 0x0}, + 957: {cur: 0x44, idx: 0x0}, + 958: {cur: 0x5e, idx: 0x0}, + 959: {cur: 0x63, idx: 0x0}, + 960: {cur: 0x72, idx: 0x0}, + 961: {cur: 0x7c, idx: 0x0}, + 962: {cur: 0x7d, idx: 0x0}, + 963: {cur: 0x85, idx: 0x25}, + 964: {cur: 0x8d, idx: 0x0}, + 965: {cur: 0xb2, idx: 0x0}, + 966: {cur: 0xc0, idx: 0x0}, + 967: {cur: 0xf6, idx: 0x0}, + 968: {cur: 0xf8, idx: 0xcb}, + 969: {cur: 0xf9, idx: 0x581}, + 970: {cur: 0xfc, idx: 0x0}, + 971: {cur: 0x105, idx: 0x0}, + 972: {cur: 0x110, idx: 0x0}, + 973: {cur: 0xc8, idx: 0x7e}, + 974: {cur: 0xeb, idx: 0xbc}, + 975: {cur: 0xfc, idx: 0x4}, + 976: {cur: 0xc8, idx: 0x0}, + 977: {cur: 0x102, idx: 0x589}, + 978: {cur: 0x4, idx: 0x396}, + 979: {cur: 0xeb, idx: 0xbc}, + 980: {cur: 0x102, idx: 0x58f}, + 981: {cur: 0x94, idx: 0x4}, + 982: {cur: 0x94, idx: 0x4}, + 983: {cur: 0x13, idx: 0xf8}, + 984: {cur: 0xeb, idx: 0xbc}, + 985: {cur: 0xf7, idx: 0x23c}, + 986: {cur: 0x85, idx: 0x25}, + 987: {cur: 0xfc, idx: 0x4}, + 988: {cur: 0xfc, idx: 0x4}, + 989: {cur: 0xfb, idx: 0x2f4}, + 990: {cur: 0xba, idx: 0x97}, + 991: {cur: 0x13, idx: 0xf8}, + 992: {cur: 0x85, idx: 0x25}, + 993: {cur: 0x8d, idx: 0x596}, + 994: {cur: 0x13, idx: 0xf8}, + 995: {cur: 0x44, idx: 0x4a3}, + 996: {cur: 0x8d, idx: 0x596}, + 997: {cur: 0x13, idx: 0xf8}, + 998: {cur: 0x44, idx: 0x4a3}, + 999: {cur: 0x7b, idx: 0x59a}, + 1000: {cur: 0x8d, idx: 0x596}, + 1001: {cur: 0x44, idx: 0x20}, + 1002: {cur: 0x44, idx: 0x20}, + 1003: {cur: 0xaa, idx: 0x35f}, + 1004: {cur: 0x44, idx: 0x20}, + 1005: {cur: 0xdc, idx: 0x4}, + 1006: {cur: 0x13, idx: 0xf8}, + 1007: {cur: 0x85, idx: 0x25}, + 1008: {cur: 0x8d, idx: 0x596}, + 1009: {cur: 0xf6, idx: 0x4}, + 1010: {cur: 0x8d, idx: 0x6e}, + 1011: {cur: 0xf6, idx: 0xc7}, + 1012: {cur: 0xaa, idx: 0x35f}, + 1013: {cur: 0xeb, idx: 0xbc}, + 1014: {cur: 0x125, idx: 0xe9}, +} // Size: 4084 bytes + +var narrowLangIndex = []uint16{ // 776 elements + // Entry 0 - 3F + 0x0000, 0x0062, 0x0064, 0x0064, 0x0064, 0x0064, 0x0064, 0x0064, + 0x0064, 0x0065, 0x0065, 0x0081, 0x0081, 0x0082, 0x0082, 0x0082, + 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, + 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, + 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, + 0x0082, 0x0082, 0x0082, 0x0082, 0x0082, 0x008b, 0x008b, 0x008e, + 0x008e, 0x008e, 0x008e, 0x008e, 0x008e, 0x008e, 0x00a8, 0x00a8, + 0x00a8, 0x00a8, 0x00a8, 0x00a8, 0x00d8, 0x00d8, 0x00d8, 0x00d8, + // Entry 40 - 7F + 0x00d8, 0x00d9, 0x00d9, 0x00d9, 0x00d9, 0x00d9, 0x00d9, 0x00dc, + 0x00dc, 0x00dc, 0x00dc, 0x00dd, 0x00dd, 0x00dd, 0x00dd, 0x00dd, + 0x00de, 0x00de, 0x00de, 0x00de, 0x00de, 0x00df, 0x00df, 0x00df, + 0x00e0, 0x00e0, 0x00e0, 0x00e0, 0x00e0, 0x00e0, 0x00e0, 0x00e0, + 0x00e0, 0x00e2, 0x00e2, 0x00e2, 0x00e2, 0x00e8, 0x00e8, 0x00ee, + 0x00ee, 0x00ee, 0x00ee, 0x00ee, 0x00f7, 0x00f7, 0x00f7, 0x00f8, + 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, + 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, + // Entry 80 - BF + 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, + 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x00f8, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + // Entry C0 - FF + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, 0x0100, + 0x0100, 0x0100, 0x0103, 0x0108, 0x0108, 0x0108, 0x0108, 0x0108, + 0x0108, 0x0108, 0x0108, 0x0108, 0x0108, 0x0108, 0x0108, 0x0108, + // Entry 100 - 13F + 0x0108, 0x0108, 0x0108, 0x0108, 0x010d, 0x010d, 0x010d, 0x010d, + 0x010d, 0x010d, 0x010d, 0x010d, 0x0111, 0x0111, 0x0112, 0x0113, + 0x0113, 0x0114, 0x0114, 0x0114, 0x0114, 0x0114, 0x0114, 0x0114, + 0x0114, 0x0114, 0x0114, 0x0114, 0x0114, 0x0171, 0x0171, 0x0172, + 0x0172, 0x0172, 0x0172, 0x0172, 0x017a, 0x017a, 0x017a, 0x017a, + 0x017a, 0x017a, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, + 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, + 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, + // Entry 140 - 17F + 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, + 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, + 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x017f, 0x0180, + 0x0180, 0x0182, 0x0182, 0x0185, 0x0185, 0x0185, 0x0185, 0x0185, + 0x0185, 0x0187, 0x0187, 0x0187, 0x0187, 0x0187, 0x0187, 0x0187, + 0x0187, 0x0187, 0x0187, 0x0187, 0x0187, 0x0187, 0x0188, 0x0188, + 0x018a, 0x018a, 0x018b, 0x018b, 0x018b, 0x018b, 0x018b, 0x018c, + 0x018c, 0x018d, 0x018d, 0x018e, 0x018e, 0x018e, 0x018e, 0x018e, + // Entry 180 - 1BF + 0x018e, 0x018e, 0x018e, 0x018f, 0x018f, 0x0193, 0x0193, 0x0193, + 0x0193, 0x0193, 0x0193, 0x0193, 0x0196, 0x0196, 0x0196, 0x0196, + 0x0196, 0x0196, 0x0196, 0x0196, 0x0196, 0x0196, 0x0197, 0x0197, + 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, + 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, 0x0197, 0x0198, 0x0198, + 0x0198, 0x0198, 0x0198, 0x0198, 0x0198, 0x0198, 0x0199, 0x0199, + 0x019b, 0x019b, 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, + 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, 0x019d, + // Entry 1C0 - 1FF + 0x019d, 0x019d, 0x01a8, 0x01a8, 0x01a8, 0x01a8, 0x01a9, 0x01a9, + 0x01a9, 0x01a9, 0x01a9, 0x01a9, 0x01a9, 0x01a9, 0x01a9, 0x01a9, + 0x01a9, 0x01aa, 0x01aa, 0x01aa, 0x01aa, 0x01aa, 0x01b5, 0x01b5, + 0x01b5, 0x01b5, 0x01b5, 0x01b5, 0x01b5, 0x01b5, 0x01b6, 0x01b6, + 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b6, + 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b6, 0x01b7, 0x01b7, 0x01b8, + 0x01b8, 0x01ba, 0x01ba, 0x01ba, 0x01bb, 0x01bb, 0x01bc, 0x01bc, + 0x01bc, 0x01bc, 0x01bc, 0x01bc, 0x01bc, 0x01bc, 0x01be, 0x01be, + // Entry 200 - 23F + 0x01be, 0x01be, 0x01be, 0x01be, 0x01be, 0x01c0, 0x01c0, 0x01c0, + 0x01c0, 0x01c0, 0x01c0, 0x01c0, 0x01c0, 0x01c1, 0x01c1, 0x01c1, + 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, + 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, + 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, + 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c2, 0x01c3, + 0x01c3, 0x01c3, 0x01c3, 0x01c3, 0x01c3, 0x01c5, 0x01c5, 0x01c5, + 0x01c5, 0x01c5, 0x01c5, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, + // Entry 240 - 27F + 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, + 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, 0x01c7, + 0x01c8, 0x01c8, 0x01c8, 0x01c8, 0x01c8, 0x01cb, 0x01cc, 0x01cc, + 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, + 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, + 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, + 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, 0x01cc, + 0x01cc, 0x01ce, 0x01ce, 0x01cf, 0x01cf, 0x01d0, 0x01d0, 0x01d0, + // Entry 280 - 2BF + 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, + 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, 0x01d0, + 0x01d2, 0x01d2, 0x01d2, 0x01d2, 0x01d2, 0x01d2, 0x01d5, 0x01d5, + 0x01d5, 0x01d5, 0x01d5, 0x01d5, 0x01d5, 0x01d5, 0x01d8, 0x01d8, + 0x01d8, 0x01d8, 0x01d9, 0x01d9, 0x01d9, 0x01d9, 0x01d9, 0x01d9, + 0x01da, 0x01da, 0x01da, 0x01da, 0x01da, 0x01db, 0x01db, 0x01db, + 0x01db, 0x01db, 0x01db, 0x01db, 0x01dc, 0x01dc, 0x01dc, 0x01dc, + 0x01dc, 0x01dc, 0x01dc, 0x01dc, 0x01dc, 0x01dc, 0x01dc, 0x01dc, + // Entry 2C0 - 2FF + 0x01de, 0x01de, 0x01de, 0x01de, 0x01de, 0x01de, 0x01de, 0x01de, + 0x01de, 0x01de, 0x01de, 0x01de, 0x01df, 0x01df, 0x01e0, 0x01e0, + 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, + 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e0, 0x01e1, 0x01e1, + 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, + 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, + 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, 0x01e1, + 0x01e1, 0x01e1, 0x01e2, 0x01e2, 0x01e2, 0x01e2, 0x01e2, 0x01e2, + // Entry 300 - 33F + 0x01e3, 0x01e3, 0x01e3, 0x01e3, 0x01eb, 0x01eb, 0x01eb, 0x01eb, +} // Size: 1576 bytes + +var narrowSymIndex = []curToIndex{ // 491 elements + 0: {cur: 0x9, idx: 0x1}, + 1: {cur: 0x11, idx: 0x4}, + 2: {cur: 0x13, idx: 0x4}, + 3: {cur: 0x18, idx: 0x9}, + 4: {cur: 0x1a, idx: 0x4}, + 5: {cur: 0x1b, idx: 0xc}, + 6: {cur: 0x25, idx: 0x4}, + 7: {cur: 0x26, idx: 0x4}, + 8: {cur: 0x27, idx: 0x10}, + 9: {cur: 0x2e, idx: 0x13}, + 10: {cur: 0x32, idx: 0x4}, + 11: {cur: 0x35, idx: 0x16}, + 12: {cur: 0x37, idx: 0x18}, + 13: {cur: 0x39, idx: 0x4}, + 14: {cur: 0x3a, idx: 0x4}, + 15: {cur: 0x41, idx: 0x4}, + 16: {cur: 0x44, idx: 0x25}, + 17: {cur: 0x45, idx: 0x4}, + 18: {cur: 0x47, idx: 0x28}, + 19: {cur: 0x4a, idx: 0x4}, + 20: {cur: 0x4b, idx: 0x4}, + 21: {cur: 0x4e, idx: 0x2c}, + 22: {cur: 0x52, idx: 0x30}, + 23: {cur: 0x53, idx: 0x4}, + 24: {cur: 0x58, idx: 0x33}, + 25: {cur: 0x5c, idx: 0x37}, + 26: {cur: 0x5e, idx: 0x3b}, + 27: {cur: 0x60, idx: 0x4}, + 28: {cur: 0x61, idx: 0x3f}, + 29: {cur: 0x63, idx: 0x3f}, + 30: {cur: 0x65, idx: 0x42}, + 31: {cur: 0x68, idx: 0x3f}, + 32: {cur: 0x6a, idx: 0x46}, + 33: {cur: 0x6e, idx: 0x49}, + 34: {cur: 0x71, idx: 0x4}, + 35: {cur: 0x72, idx: 0x4}, + 36: {cur: 0x73, idx: 0x4f}, + 37: {cur: 0x75, idx: 0x51}, + 38: {cur: 0x77, idx: 0x54}, + 39: {cur: 0x78, idx: 0x57}, + 40: {cur: 0x7c, idx: 0x5a}, + 41: {cur: 0x7d, idx: 0x5e}, + 42: {cur: 0x81, idx: 0x30}, + 43: {cur: 0x83, idx: 0x4}, + 44: {cur: 0x85, idx: 0x25}, + 45: {cur: 0x88, idx: 0x67}, + 46: {cur: 0x89, idx: 0x6b}, + 47: {cur: 0x8a, idx: 0x6e}, + 48: {cur: 0x8d, idx: 0x6e}, + 49: {cur: 0x8f, idx: 0x4}, + 50: {cur: 0x90, idx: 0x72}, + 51: {cur: 0x91, idx: 0x76}, + 52: {cur: 0x92, idx: 0x7a}, + 53: {cur: 0x93, idx: 0x7e}, + 54: {cur: 0x94, idx: 0x4}, + 55: {cur: 0x96, idx: 0x81}, + 56: {cur: 0x9b, idx: 0x84}, + 57: {cur: 0xa3, idx: 0x87}, + 58: {cur: 0xa8, idx: 0x8a}, + 59: {cur: 0xa9, idx: 0x8c}, + 60: {cur: 0xae, idx: 0x7e}, + 61: {cur: 0xb2, idx: 0x4}, + 62: {cur: 0xb5, idx: 0x94}, + 63: {cur: 0xb9, idx: 0x4}, + 64: {cur: 0xba, idx: 0x97}, + 65: {cur: 0xbc, idx: 0x9b}, + 66: {cur: 0xbe, idx: 0x30}, + 67: {cur: 0xbf, idx: 0x7e}, + 68: {cur: 0xc0, idx: 0x4}, + 69: {cur: 0xc7, idx: 0xa2}, + 70: {cur: 0xc8, idx: 0x7e}, + 71: {cur: 0xc9, idx: 0xa6}, + 72: {cur: 0xcc, idx: 0xaa}, + 73: {cur: 0xd0, idx: 0xae}, + 74: {cur: 0xd2, idx: 0xb2}, + 75: {cur: 0xd3, idx: 0x18}, + 76: {cur: 0xd4, idx: 0xb6}, + 77: {cur: 0xd6, idx: 0x4}, + 78: {cur: 0xdb, idx: 0x30}, + 79: {cur: 0xdc, idx: 0x4}, + 80: {cur: 0xdd, idx: 0x3f}, + 81: {cur: 0xe2, idx: 0x4}, + 82: {cur: 0xe4, idx: 0x3f}, + 83: {cur: 0xe5, idx: 0xb9}, + 84: {cur: 0xe9, idx: 0x3f}, + 85: {cur: 0xeb, idx: 0xbc}, + 86: {cur: 0xf1, idx: 0xc0}, + 87: {cur: 0xf4, idx: 0xc3}, + 88: {cur: 0xf5, idx: 0x4}, + 89: {cur: 0xf6, idx: 0x4}, + 90: {cur: 0xf8, idx: 0xcb}, + 91: {cur: 0xfc, idx: 0x4}, + 92: {cur: 0x101, idx: 0x4}, + 93: {cur: 0x104, idx: 0x10}, + 94: {cur: 0x105, idx: 0xd3}, + 95: {cur: 0x110, idx: 0x4}, + 96: {cur: 0x125, idx: 0xe9}, + 97: {cur: 0x127, idx: 0xeb}, + 98: {cur: 0xd0, idx: 0xee}, + 99: {cur: 0xf6, idx: 0xc7}, + 100: {cur: 0xf6, idx: 0xc7}, + 101: {cur: 0x11, idx: 0x128}, + 102: {cur: 0x13, idx: 0xf8}, + 103: {cur: 0x1a, idx: 0x12c}, + 104: {cur: 0x25, idx: 0x13a}, + 105: {cur: 0x26, idx: 0x13e}, + 106: {cur: 0x32, idx: 0x142}, + 107: {cur: 0x39, idx: 0x146}, + 108: {cur: 0x3a, idx: 0x1c}, + 109: {cur: 0x41, idx: 0x14a}, + 110: {cur: 0x44, idx: 0x20}, + 111: {cur: 0x45, idx: 0x14e}, + 112: {cur: 0x4b, idx: 0x152}, + 113: {cur: 0x53, idx: 0x156}, + 114: {cur: 0x60, idx: 0x16e}, + 115: {cur: 0x63, idx: 0x172}, + 116: {cur: 0x71, idx: 0x177}, + 117: {cur: 0x72, idx: 0x4b}, + 118: {cur: 0x83, idx: 0x18c}, + 119: {cur: 0x85, idx: 0x62}, + 120: {cur: 0x8f, idx: 0x1a4}, + 121: {cur: 0xb2, idx: 0x90}, + 122: {cur: 0xc0, idx: 0x9e}, + 123: {cur: 0xd6, idx: 0x1ee}, + 124: {cur: 0xe2, idx: 0x203}, + 125: {cur: 0xf5, idx: 0x21b}, + 126: {cur: 0xf6, idx: 0xc7}, + 127: {cur: 0xfc, idx: 0xcf}, + 128: {cur: 0x101, idx: 0x21f}, + 129: {cur: 0x26, idx: 0x4}, + 130: {cur: 0x37, idx: 0x0}, + 131: {cur: 0x52, idx: 0x0}, + 132: {cur: 0x75, idx: 0x0}, + 133: {cur: 0x81, idx: 0x0}, + 134: {cur: 0xbe, idx: 0x0}, + 135: {cur: 0xc9, idx: 0x0}, + 136: {cur: 0xd3, idx: 0x0}, + 137: {cur: 0xdb, idx: 0x0}, + 138: {cur: 0xf6, idx: 0xc7}, + 139: {cur: 0xd0, idx: 0x244}, + 140: {cur: 0xe9, idx: 0x248}, + 141: {cur: 0xf6, idx: 0xc7}, + 142: {cur: 0x13, idx: 0x6}, + 143: {cur: 0x1a, idx: 0x24c}, + 144: {cur: 0x25, idx: 0x251}, + 145: {cur: 0x32, idx: 0x255}, + 146: {cur: 0x37, idx: 0x258}, + 147: {cur: 0x39, idx: 0x146}, + 148: {cur: 0x3a, idx: 0x1c}, + 149: {cur: 0x4a, idx: 0x25b}, + 150: {cur: 0x4b, idx: 0x260}, + 151: {cur: 0x53, idx: 0x264}, + 152: {cur: 0x60, idx: 0x16e}, + 153: {cur: 0x61, idx: 0x268}, + 154: {cur: 0x71, idx: 0x26d}, + 155: {cur: 0x81, idx: 0x270}, + 156: {cur: 0x83, idx: 0x275}, + 157: {cur: 0x8f, idx: 0x278}, + 158: {cur: 0x94, idx: 0x27c}, + 159: {cur: 0xb2, idx: 0x90}, + 160: {cur: 0xb9, idx: 0x27f}, + 161: {cur: 0xc0, idx: 0x9e}, + 162: {cur: 0xd2, idx: 0x282}, + 163: {cur: 0xd6, idx: 0x28a}, + 164: {cur: 0xdc, idx: 0x28e}, + 165: {cur: 0xf5, idx: 0x21b}, + 166: {cur: 0x101, idx: 0x291}, + 167: {cur: 0x110, idx: 0xdc}, + 168: {cur: 0x11, idx: 0x0}, + 169: {cur: 0x13, idx: 0x0}, + 170: {cur: 0x1a, idx: 0x0}, + 171: {cur: 0x1b, idx: 0x0}, + 172: {cur: 0x25, idx: 0x0}, + 173: {cur: 0x26, idx: 0x0}, + 174: {cur: 0x2e, idx: 0x0}, + 175: {cur: 0x32, idx: 0x0}, + 176: {cur: 0x37, idx: 0x0}, + 177: {cur: 0x39, idx: 0x0}, + 178: {cur: 0x3a, idx: 0x0}, + 179: {cur: 0x41, idx: 0x0}, + 180: {cur: 0x44, idx: 0x0}, + 181: {cur: 0x45, idx: 0x0}, + 182: {cur: 0x47, idx: 0x0}, + 183: {cur: 0x4b, idx: 0x0}, + 184: {cur: 0x53, idx: 0x0}, + 185: {cur: 0x60, idx: 0x0}, + 186: {cur: 0x68, idx: 0x0}, + 187: {cur: 0x71, idx: 0x0}, + 188: {cur: 0x72, idx: 0x0}, + 189: {cur: 0x7c, idx: 0x0}, + 190: {cur: 0x7d, idx: 0x0}, + 191: {cur: 0x83, idx: 0x0}, + 192: {cur: 0x88, idx: 0x0}, + 193: {cur: 0x8d, idx: 0x0}, + 194: {cur: 0x8f, idx: 0x0}, + 195: {cur: 0x90, idx: 0x0}, + 196: {cur: 0x91, idx: 0x0}, + 197: {cur: 0x94, idx: 0x0}, + 198: {cur: 0xa9, idx: 0x0}, + 199: {cur: 0xb2, idx: 0x0}, + 200: {cur: 0xb9, idx: 0x0}, + 201: {cur: 0xba, idx: 0x0}, + 202: {cur: 0xc0, idx: 0x0}, + 203: {cur: 0xc7, idx: 0x0}, + 204: {cur: 0xcc, idx: 0x0}, + 205: {cur: 0xd0, idx: 0x0}, + 206: {cur: 0xd6, idx: 0x0}, + 207: {cur: 0xdc, idx: 0x0}, + 208: {cur: 0xe2, idx: 0x0}, + 209: {cur: 0xe4, idx: 0x0}, + 210: {cur: 0xf4, idx: 0x0}, + 211: {cur: 0xf5, idx: 0x0}, + 212: {cur: 0xf6, idx: 0x0}, + 213: {cur: 0xf8, idx: 0x0}, + 214: {cur: 0x101, idx: 0x0}, + 215: {cur: 0x105, idx: 0x0}, + 216: {cur: 0xf6, idx: 0xc7}, + 217: {cur: 0x58, idx: 0x2a8}, + 218: {cur: 0x92, idx: 0x2b8}, + 219: {cur: 0xf1, idx: 0x2c1}, + 220: {cur: 0xf6, idx: 0xc7}, + 221: {cur: 0x104, idx: 0x0}, + 222: {cur: 0xf6, idx: 0xc7}, + 223: {cur: 0xd0, idx: 0x2ed}, + 224: {cur: 0xd0, idx: 0x4f}, + 225: {cur: 0xf6, idx: 0xc7}, + 226: {cur: 0x1b, idx: 0x301}, + 227: {cur: 0x35, idx: 0x0}, + 228: {cur: 0x72, idx: 0x4b}, + 229: {cur: 0xf6, idx: 0xc7}, + 230: {cur: 0x125, idx: 0x0}, + 231: {cur: 0x127, idx: 0x0}, + 232: {cur: 0x52, idx: 0x304}, + 233: {cur: 0x81, idx: 0x304}, + 234: {cur: 0xbe, idx: 0x304}, + 235: {cur: 0xd0, idx: 0x4f}, + 236: {cur: 0xdb, idx: 0x304}, + 237: {cur: 0xf6, idx: 0xc7}, + 238: {cur: 0x4a, idx: 0x318}, + 239: {cur: 0x61, idx: 0x320}, + 240: {cur: 0x6a, idx: 0x325}, + 241: {cur: 0x89, idx: 0x32a}, + 242: {cur: 0xd0, idx: 0x4f}, + 243: {cur: 0xd4, idx: 0x32d}, + 244: {cur: 0xe9, idx: 0x0}, + 245: {cur: 0xf6, idx: 0xc7}, + 246: {cur: 0x127, idx: 0x8a}, + 247: {cur: 0x5e, idx: 0x0}, + 248: {cur: 0x1b, idx: 0x349}, + 249: {cur: 0x27, idx: 0x34c}, + 250: {cur: 0x4b, idx: 0xa2}, + 251: {cur: 0x58, idx: 0x3f}, + 252: {cur: 0x81, idx: 0x34f}, + 253: {cur: 0xcc, idx: 0x352}, + 254: {cur: 0xdb, idx: 0x34f}, + 255: {cur: 0x101, idx: 0x291}, + 256: {cur: 0x58, idx: 0x0}, + 257: {cur: 0xd0, idx: 0x4f}, + 258: {cur: 0xf6, idx: 0xc7}, + 259: {cur: 0x58, idx: 0x33}, + 260: {cur: 0x61, idx: 0x268}, + 261: {cur: 0xe4, idx: 0x37b}, + 262: {cur: 0xe9, idx: 0x248}, + 263: {cur: 0x104, idx: 0x380}, + 264: {cur: 0x37, idx: 0x384}, + 265: {cur: 0x61, idx: 0x3f}, + 266: {cur: 0xd0, idx: 0xae}, + 267: {cur: 0xe4, idx: 0x3f}, + 268: {cur: 0xe9, idx: 0x3f}, + 269: {cur: 0x61, idx: 0x3f}, + 270: {cur: 0xd0, idx: 0xae}, + 271: {cur: 0xe4, idx: 0x3f}, + 272: {cur: 0xe9, idx: 0x3f}, + 273: {cur: 0x104, idx: 0x392}, + 274: {cur: 0xf6, idx: 0xc7}, + 275: {cur: 0xf6, idx: 0xc7}, + 276: {cur: 0x9, idx: 0x0}, + 277: {cur: 0x11, idx: 0x0}, + 278: {cur: 0x13, idx: 0x0}, + 279: {cur: 0x18, idx: 0x0}, + 280: {cur: 0x1a, idx: 0x0}, + 281: {cur: 0x1b, idx: 0x0}, + 282: {cur: 0x25, idx: 0x0}, + 283: {cur: 0x26, idx: 0x0}, + 284: {cur: 0x27, idx: 0x0}, + 285: {cur: 0x2e, idx: 0x0}, + 286: {cur: 0x32, idx: 0x0}, + 287: {cur: 0x35, idx: 0x0}, + 288: {cur: 0x37, idx: 0x0}, + 289: {cur: 0x39, idx: 0x0}, + 290: {cur: 0x3a, idx: 0x0}, + 291: {cur: 0x41, idx: 0x0}, + 292: {cur: 0x44, idx: 0x0}, + 293: {cur: 0x45, idx: 0x0}, + 294: {cur: 0x47, idx: 0x0}, + 295: {cur: 0x4a, idx: 0x0}, + 296: {cur: 0x4b, idx: 0x0}, + 297: {cur: 0x4e, idx: 0x0}, + 298: {cur: 0x52, idx: 0x0}, + 299: {cur: 0x53, idx: 0x0}, + 300: {cur: 0x58, idx: 0x0}, + 301: {cur: 0x5c, idx: 0x0}, + 302: {cur: 0x60, idx: 0x0}, + 303: {cur: 0x61, idx: 0x0}, + 304: {cur: 0x65, idx: 0x0}, + 305: {cur: 0x68, idx: 0x0}, + 306: {cur: 0x6a, idx: 0x0}, + 307: {cur: 0x6e, idx: 0x0}, + 308: {cur: 0x71, idx: 0x0}, + 309: {cur: 0x72, idx: 0x0}, + 310: {cur: 0x73, idx: 0x0}, + 311: {cur: 0x75, idx: 0x0}, + 312: {cur: 0x77, idx: 0x0}, + 313: {cur: 0x78, idx: 0x0}, + 314: {cur: 0x7c, idx: 0x0}, + 315: {cur: 0x7d, idx: 0x0}, + 316: {cur: 0x81, idx: 0x0}, + 317: {cur: 0x83, idx: 0x0}, + 318: {cur: 0x88, idx: 0x0}, + 319: {cur: 0x89, idx: 0x0}, + 320: {cur: 0x8a, idx: 0x0}, + 321: {cur: 0x8d, idx: 0x0}, + 322: {cur: 0x8f, idx: 0x0}, + 323: {cur: 0x90, idx: 0x0}, + 324: {cur: 0x91, idx: 0x0}, + 325: {cur: 0x92, idx: 0x0}, + 326: {cur: 0x93, idx: 0x0}, + 327: {cur: 0x94, idx: 0x0}, + 328: {cur: 0x96, idx: 0x0}, + 329: {cur: 0x9b, idx: 0x0}, + 330: {cur: 0xa3, idx: 0x0}, + 331: {cur: 0xa8, idx: 0x0}, + 332: {cur: 0xa9, idx: 0x0}, + 333: {cur: 0xae, idx: 0x0}, + 334: {cur: 0xb2, idx: 0x0}, + 335: {cur: 0xb5, idx: 0x0}, + 336: {cur: 0xb9, idx: 0x0}, + 337: {cur: 0xba, idx: 0x0}, + 338: {cur: 0xbc, idx: 0x0}, + 339: {cur: 0xbe, idx: 0x0}, + 340: {cur: 0xbf, idx: 0x0}, + 341: {cur: 0xc0, idx: 0x0}, + 342: {cur: 0xc7, idx: 0x0}, + 343: {cur: 0xc8, idx: 0x0}, + 344: {cur: 0xc9, idx: 0x0}, + 345: {cur: 0xcc, idx: 0x0}, + 346: {cur: 0xd0, idx: 0x0}, + 347: {cur: 0xd3, idx: 0x0}, + 348: {cur: 0xd4, idx: 0x0}, + 349: {cur: 0xd6, idx: 0x0}, + 350: {cur: 0xdb, idx: 0x0}, + 351: {cur: 0xdc, idx: 0x0}, + 352: {cur: 0xdd, idx: 0x0}, + 353: {cur: 0xe2, idx: 0x0}, + 354: {cur: 0xe4, idx: 0x0}, + 355: {cur: 0xe5, idx: 0x0}, + 356: {cur: 0xe9, idx: 0x0}, + 357: {cur: 0xeb, idx: 0x0}, + 358: {cur: 0xf1, idx: 0x0}, + 359: {cur: 0xf4, idx: 0x0}, + 360: {cur: 0xf5, idx: 0x0}, + 361: {cur: 0xf6, idx: 0x0}, + 362: {cur: 0xf8, idx: 0x0}, + 363: {cur: 0x101, idx: 0x0}, + 364: {cur: 0x104, idx: 0x0}, + 365: {cur: 0x105, idx: 0x0}, + 366: {cur: 0x110, idx: 0x0}, + 367: {cur: 0x125, idx: 0x0}, + 368: {cur: 0x127, idx: 0x0}, + 369: {cur: 0xf6, idx: 0xc7}, + 370: {cur: 0x58, idx: 0x3e5}, + 371: {cur: 0x89, idx: 0x32a}, + 372: {cur: 0x92, idx: 0x2b8}, + 373: {cur: 0xbc, idx: 0x41a}, + 374: {cur: 0xd0, idx: 0x4f}, + 375: {cur: 0xd4, idx: 0x421}, + 376: {cur: 0xf6, idx: 0xc7}, + 377: {cur: 0x127, idx: 0x441}, + 378: {cur: 0x37, idx: 0x258}, + 379: {cur: 0x65, idx: 0x0}, + 380: {cur: 0x89, idx: 0x6b}, + 381: {cur: 0xbc, idx: 0x9b}, + 382: {cur: 0x127, idx: 0xeb}, + 383: {cur: 0xf6, idx: 0xc7}, + 384: {cur: 0xd0, idx: 0xee}, + 385: {cur: 0xf6, idx: 0xc7}, + 386: {cur: 0x89, idx: 0x32a}, + 387: {cur: 0xd2, idx: 0x46d}, + 388: {cur: 0xf6, idx: 0xc7}, + 389: {cur: 0xae, idx: 0x474}, + 390: {cur: 0xf6, idx: 0xc7}, + 391: {cur: 0xf6, idx: 0xc7}, + 392: {cur: 0xd0, idx: 0x48e}, + 393: {cur: 0xf6, idx: 0xc7}, + 394: {cur: 0xf6, idx: 0xc7}, + 395: {cur: 0xf6, idx: 0xc7}, + 396: {cur: 0xf6, idx: 0xc7}, + 397: {cur: 0xf6, idx: 0xc7}, + 398: {cur: 0xf6, idx: 0xc7}, + 399: {cur: 0x37, idx: 0x258}, + 400: {cur: 0x58, idx: 0x3e5}, + 401: {cur: 0xbe, idx: 0x49b}, + 402: {cur: 0xf6, idx: 0xc7}, + 403: {cur: 0x44, idx: 0x4a3}, + 404: {cur: 0x85, idx: 0x4a3}, + 405: {cur: 0xd0, idx: 0x4a7}, + 406: {cur: 0xf6, idx: 0xc7}, + 407: {cur: 0xf6, idx: 0xc7}, + 408: {cur: 0xf6, idx: 0xc7}, + 409: {cur: 0xd0, idx: 0x4b2}, + 410: {cur: 0xf6, idx: 0xc7}, + 411: {cur: 0xd0, idx: 0x4f}, + 412: {cur: 0xf6, idx: 0xc7}, + 413: {cur: 0x25, idx: 0x251}, + 414: {cur: 0x32, idx: 0x255}, + 415: {cur: 0x39, idx: 0x146}, + 416: {cur: 0x3a, idx: 0x9b}, + 417: {cur: 0x53, idx: 0x264}, + 418: {cur: 0x58, idx: 0x4b9}, + 419: {cur: 0x72, idx: 0x4b}, + 420: {cur: 0x75, idx: 0x4bc}, + 421: {cur: 0x83, idx: 0x275}, + 422: {cur: 0xf5, idx: 0x21b}, + 423: {cur: 0xf6, idx: 0xc7}, + 424: {cur: 0xf6, idx: 0xc7}, + 425: {cur: 0xf6, idx: 0xc7}, + 426: {cur: 0x1b, idx: 0x0}, + 427: {cur: 0x37, idx: 0x258}, + 428: {cur: 0x7c, idx: 0x0}, + 429: {cur: 0x7d, idx: 0x0}, + 430: {cur: 0x88, idx: 0x0}, + 431: {cur: 0x91, idx: 0x0}, + 432: {cur: 0xa9, idx: 0x0}, + 433: {cur: 0xc9, idx: 0x4c6}, + 434: {cur: 0xcc, idx: 0x352}, + 435: {cur: 0xd2, idx: 0x4c9}, + 436: {cur: 0x105, idx: 0x0}, + 437: {cur: 0xf6, idx: 0xc7}, + 438: {cur: 0xf6, idx: 0xc7}, + 439: {cur: 0xf6, idx: 0xc7}, + 440: {cur: 0xdb, idx: 0x4d7}, + 441: {cur: 0xf6, idx: 0xc7}, + 442: {cur: 0xf6, idx: 0xc7}, + 443: {cur: 0xf6, idx: 0xc7}, + 444: {cur: 0x1a, idx: 0x24c}, + 445: {cur: 0x32, idx: 0x255}, + 446: {cur: 0xd0, idx: 0x4f}, + 447: {cur: 0xf6, idx: 0xc7}, + 448: {cur: 0xbf, idx: 0x4f1}, + 449: {cur: 0xf6, idx: 0xc7}, + 450: {cur: 0xf6, idx: 0xc7}, + 451: {cur: 0xd0, idx: 0x500}, + 452: {cur: 0xf6, idx: 0xc7}, + 453: {cur: 0xd0, idx: 0x4f}, + 454: {cur: 0xf6, idx: 0xc7}, + 455: {cur: 0xf6, idx: 0xc7}, + 456: {cur: 0x65, idx: 0x515}, + 457: {cur: 0xd0, idx: 0x4f}, + 458: {cur: 0xf6, idx: 0xc7}, + 459: {cur: 0x37, idx: 0x258}, + 460: {cur: 0x93, idx: 0x52c}, + 461: {cur: 0xf6, idx: 0xc7}, + 462: {cur: 0xf6, idx: 0xc7}, + 463: {cur: 0xf6, idx: 0xc7}, + 464: {cur: 0x65, idx: 0x515}, + 465: {cur: 0xf6, idx: 0xc7}, + 466: {cur: 0x37, idx: 0x552}, + 467: {cur: 0x65, idx: 0x515}, + 468: {cur: 0xf6, idx: 0xc7}, + 469: {cur: 0x5c, idx: 0x0}, + 470: {cur: 0xd0, idx: 0x4f}, + 471: {cur: 0xf6, idx: 0xc7}, + 472: {cur: 0xf6, idx: 0xc7}, + 473: {cur: 0xf6, idx: 0xc7}, + 474: {cur: 0xf6, idx: 0xc7}, + 475: {cur: 0xf6, idx: 0xc7}, + 476: {cur: 0xd0, idx: 0x4f}, + 477: {cur: 0xf6, idx: 0xc7}, + 478: {cur: 0xf6, idx: 0xc7}, + 479: {cur: 0xf6, idx: 0xc7}, + 480: {cur: 0xf6, idx: 0xc7}, + 481: {cur: 0xf6, idx: 0xc7}, + 482: {cur: 0xd0, idx: 0x4f}, + 483: {cur: 0x37, idx: 0x59e}, + 484: {cur: 0x52, idx: 0x34f}, + 485: {cur: 0x75, idx: 0x4bc}, + 486: {cur: 0x81, idx: 0x34f}, + 487: {cur: 0xbe, idx: 0x34f}, + 488: {cur: 0xc9, idx: 0x5a1}, + 489: {cur: 0xdb, idx: 0x34f}, + 490: {cur: 0xf6, idx: 0xc7}, +} // Size: 1988 bytes + +// Total table size 18885 bytes (18KiB); checksum: BE08FD0B diff --git a/vendor/golang.org/x/text/internal/format/format.go b/vendor/golang.org/x/text/internal/format/format.go new file mode 100644 index 0000000..ee1c57a --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/format.go @@ -0,0 +1,41 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package format contains types for defining language-specific formatting of +// values. +// +// This package is internal now, but will eventually be exposed after the API +// settles. +package format // import "golang.org/x/text/internal/format" + +import ( + "fmt" + + "golang.org/x/text/language" +) + +// State represents the printer state passed to custom formatters. It provides +// access to the fmt.State interface and the sentence and language-related +// context. +type State interface { + fmt.State + + // Language reports the requested language in which to render a message. + Language() language.Tag + + // TODO: consider this and removing rune from the Format method in the + // Formatter interface. + // + // Verb returns the format variant to render, analogous to the types used + // in fmt. Use 'v' for the default or only variant. + // Verb() rune + + // TODO: more info: + // - sentence context such as linguistic features passed by the translator. +} + +// Formatter is analogous to fmt.Formatter. +type Formatter interface { + Format(state State, verb rune) +} diff --git a/vendor/golang.org/x/text/internal/format/parser.go b/vendor/golang.org/x/text/internal/format/parser.go new file mode 100644 index 0000000..855aed7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/format/parser.go @@ -0,0 +1,358 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package format + +import ( + "reflect" + "unicode/utf8" +) + +// A Parser parses a format string. The result from the parse are set in the +// struct fields. +type Parser struct { + Verb rune + + WidthPresent bool + PrecPresent bool + Minus bool + Plus bool + Sharp bool + Space bool + Zero bool + + // For the formats %+v %#v, we set the plusV/sharpV flags + // and clear the plus/sharp flags since %+v and %#v are in effect + // different, flagless formats set at the top level. + PlusV bool + SharpV bool + + HasIndex bool + + Width int + Prec int // precision + + // retain arguments across calls. + Args []interface{} + // retain current argument number across calls + ArgNum int + + // reordered records whether the format string used argument reordering. + Reordered bool + // goodArgNum records whether the most recent reordering directive was valid. + goodArgNum bool + + // position info + format string + startPos int + endPos int + Status Status +} + +// Reset initializes a parser to scan format strings for the given args. +func (p *Parser) Reset(args []interface{}) { + p.Args = args + p.ArgNum = 0 + p.startPos = 0 + p.Reordered = false +} + +// Text returns the part of the format string that was parsed by the last call +// to Scan. It returns the original substitution clause if the current scan +// parsed a substitution. +func (p *Parser) Text() string { return p.format[p.startPos:p.endPos] } + +// SetFormat sets a new format string to parse. It does not reset the argument +// count. +func (p *Parser) SetFormat(format string) { + p.format = format + p.startPos = 0 + p.endPos = 0 +} + +// Status indicates the result type of a call to Scan. +type Status int + +const ( + StatusText Status = iota + StatusSubstitution + StatusBadWidthSubstitution + StatusBadPrecSubstitution + StatusNoVerb + StatusBadArgNum + StatusMissingArg +) + +// ClearFlags reset the parser to default behavior. +func (p *Parser) ClearFlags() { + p.WidthPresent = false + p.PrecPresent = false + p.Minus = false + p.Plus = false + p.Sharp = false + p.Space = false + p.Zero = false + + p.PlusV = false + p.SharpV = false + + p.HasIndex = false +} + +// Scan scans the next part of the format string and sets the status to +// indicate whether it scanned a string literal, substitution or error. +func (p *Parser) Scan() bool { + p.Status = StatusText + format := p.format + end := len(format) + if p.endPos >= end { + return false + } + afterIndex := false // previous item in format was an index like [3]. + + p.startPos = p.endPos + p.goodArgNum = true + i := p.startPos + for i < end && format[i] != '%' { + i++ + } + if i > p.startPos { + p.endPos = i + return true + } + // Process one verb + i++ + + p.Status = StatusSubstitution + + // Do we have flags? + p.ClearFlags() + +simpleFormat: + for ; i < end; i++ { + c := p.format[i] + switch c { + case '#': + p.Sharp = true + case '0': + p.Zero = !p.Minus // Only allow zero padding to the left. + case '+': + p.Plus = true + case '-': + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + case ' ': + p.Space = true + default: + // Fast path for common case of ascii lower case simple verbs + // without precision or width or argument indices. + if 'a' <= c && c <= 'z' && p.ArgNum < len(p.Args) { + if c == 'v' { + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + } + p.Verb = rune(c) + p.ArgNum++ + p.endPos = i + 1 + return true + } + // Format is more complex than simple flags and a verb or is malformed. + break simpleFormat + } + } + + // Do we have an explicit argument index? + i, afterIndex = p.updateArgNumber(format, i) + + // Do we have width? + if i < end && format[i] == '*' { + i++ + p.Width, p.WidthPresent = p.intFromArg() + + if !p.WidthPresent { + p.Status = StatusBadWidthSubstitution + } + + // We have a negative width, so take its value and ensure + // that the minus flag is set + if p.Width < 0 { + p.Width = -p.Width + p.Minus = true + p.Zero = false // Do not pad with zeros to the right. + } + afterIndex = false + } else { + p.Width, p.WidthPresent, i = parsenum(format, i, end) + if afterIndex && p.WidthPresent { // "%[3]2d" + p.goodArgNum = false + } + } + + // Do we have precision? + if i+1 < end && format[i] == '.' { + i++ + if afterIndex { // "%[3].2d" + p.goodArgNum = false + } + i, afterIndex = p.updateArgNumber(format, i) + if i < end && format[i] == '*' { + i++ + p.Prec, p.PrecPresent = p.intFromArg() + // Negative precision arguments don't make sense + if p.Prec < 0 { + p.Prec = 0 + p.PrecPresent = false + } + if !p.PrecPresent { + p.Status = StatusBadPrecSubstitution + } + afterIndex = false + } else { + p.Prec, p.PrecPresent, i = parsenum(format, i, end) + if !p.PrecPresent { + p.Prec = 0 + p.PrecPresent = true + } + } + } + + if !afterIndex { + i, afterIndex = p.updateArgNumber(format, i) + } + p.HasIndex = afterIndex + + if i >= end { + p.endPos = i + p.Status = StatusNoVerb + return true + } + + verb, w := utf8.DecodeRuneInString(format[i:]) + p.endPos = i + w + p.Verb = verb + + switch { + case verb == '%': // Percent does not absorb operands and ignores f.wid and f.prec. + p.startPos = p.endPos - 1 + p.Status = StatusText + case !p.goodArgNum: + p.Status = StatusBadArgNum + case p.ArgNum >= len(p.Args): // No argument left over to print for the current verb. + p.Status = StatusMissingArg + p.ArgNum++ + case verb == 'v': + // Go syntax + p.SharpV = p.Sharp + p.Sharp = false + // Struct-field syntax + p.PlusV = p.Plus + p.Plus = false + fallthrough + default: + p.ArgNum++ + } + return true +} + +// intFromArg gets the ArgNumth element of Args. On return, isInt reports +// whether the argument has integer type. +func (p *Parser) intFromArg() (num int, isInt bool) { + if p.ArgNum < len(p.Args) { + arg := p.Args[p.ArgNum] + num, isInt = arg.(int) // Almost always OK. + if !isInt { + // Work harder. + switch v := reflect.ValueOf(arg); v.Kind() { + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + n := v.Int() + if int64(int(n)) == n { + num = int(n) + isInt = true + } + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + n := v.Uint() + if int64(n) >= 0 && uint64(int(n)) == n { + num = int(n) + isInt = true + } + default: + // Already 0, false. + } + } + p.ArgNum++ + if tooLarge(num) { + num = 0 + isInt = false + } + } + return +} + +// parseArgNumber returns the value of the bracketed number, minus 1 +// (explicit argument numbers are one-indexed but we want zero-indexed). +// The opening bracket is known to be present at format[0]. +// The returned values are the index, the number of bytes to consume +// up to the closing paren, if present, and whether the number parsed +// ok. The bytes to consume will be 1 if no closing paren is present. +func parseArgNumber(format string) (index int, wid int, ok bool) { + // There must be at least 3 bytes: [n]. + if len(format) < 3 { + return 0, 1, false + } + + // Find closing bracket. + for i := 1; i < len(format); i++ { + if format[i] == ']' { + width, ok, newi := parsenum(format, 1, i) + if !ok || newi != i { + return 0, i + 1, false + } + return width - 1, i + 1, true // arg numbers are one-indexed and skip paren. + } + } + return 0, 1, false +} + +// updateArgNumber returns the next argument to evaluate, which is either the value of the passed-in +// argNum or the value of the bracketed integer that begins format[i:]. It also returns +// the new value of i, that is, the index of the next byte of the format to process. +func (p *Parser) updateArgNumber(format string, i int) (newi int, found bool) { + if len(format) <= i || format[i] != '[' { + return i, false + } + p.Reordered = true + index, wid, ok := parseArgNumber(format[i:]) + if ok && 0 <= index && index < len(p.Args) { + p.ArgNum = index + return i + wid, true + } + p.goodArgNum = false + return i + wid, ok +} + +// tooLarge reports whether the magnitude of the integer is +// too large to be used as a formatting width or precision. +func tooLarge(x int) bool { + const max int = 1e6 + return x > max || x < -max +} + +// parsenum converts ASCII to integer. num is 0 (and isnum is false) if no number present. +func parsenum(s string, start, end int) (num int, isnum bool, newi int) { + if start >= end { + return 0, false, end + } + for newi = start; newi < end && '0' <= s[newi] && s[newi] <= '9'; newi++ { + if tooLarge(num) { + return 0, false, end // Overflow; crazy long number most likely. + } + num = num*10 + int(s[newi]-'0') + isnum = true + } + return +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 0000000..cdfdb74 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000..46a0015 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000..1b36935 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000..8c1b666 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000..8d81072 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000..a09ed19 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, + // Entry 20 - 3F + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, + // Entry 80 - 9F + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, + // Entry A0 - BF + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, + // Entry C0 - DF + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, + // Entry E0 - FF + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, + // Entry 100 - 11F + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, + // Entry 120 - 13F + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, + // Entry 140 - 15F + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, + // Entry 160 - 17F + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, + // Entry 200 - 21F + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, + // Entry 240 - 25F + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, + // Entry 2A0 - 2BF + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, + // Entry 300 - 31F + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000..ca135d2 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000..4ae78e0 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000..9b20b88 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000..09d41c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findTypeForKey returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 0000000..231b4fb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000..75a2dbc --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000..aad1e0a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000..14167e7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3494 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8798 + +const NumScripts = 261 + +const NumRegions = 358 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, +} + +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, + // Entry 40 - 7F + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry 80 - BF + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, +} + +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1052 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, + // Entry 140 - 17F + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + // Entry 480 - 4BF + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1312 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, + // Entry 80 - BF + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, + // Entry C0 - FF + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, + // Entry 100 - 13F + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, + // Entry 140 - 17F + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, + // Entry 80 - BF + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, + // Entry C0 - FF + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, + // Entry 100 - 13F + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, + // Entry 140 - 17F + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, +} + +// Size: 2128 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x67, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x69, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 105 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe8}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, + // Entry 80 - BF + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, + // Entry C0 - FF + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, + // Entry 140 - 17F + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, +} + +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000..e7afd31 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/number/common.go b/vendor/golang.org/x/text/internal/number/common.go new file mode 100644 index 0000000..a6e9c8e --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/common.go @@ -0,0 +1,55 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" +) + +// A system identifies a CLDR numbering system. +type system byte + +type systemData struct { + id system + digitSize byte // number of UTF-8 bytes per digit + zero [utf8.UTFMax]byte // UTF-8 sequence of zero digit. +} + +// A SymbolType identifies a symbol of a specific kind. +type SymbolType int + +const ( + SymDecimal SymbolType = iota + SymGroup + SymList + SymPercentSign + SymPlusSign + SymMinusSign + SymExponential + SymSuperscriptingExponent + SymPerMille + SymInfinity + SymNan + SymTimeSeparator + + NumSymbolTypes +) + +const hasNonLatnMask = 0x8000 + +// symOffset is an offset into altSymData if the bit indicated by hasNonLatnMask +// is not 0 (with this bit masked out), and an offset into symIndex otherwise. +// +// TODO: this type can be a byte again if we use an indirection into altsymData +// and introduce an alt -> offset slice (the length of this will be number of +// alternatives plus 1). This also allows getting rid of the compactTag field +// in altSymData. In total this will save about 1K. +type symOffset uint16 + +type altSymData struct { + compactTag compact.ID + symIndex symOffset + system system +} diff --git a/vendor/golang.org/x/text/internal/number/decimal.go b/vendor/golang.org/x/text/internal/number/decimal.go new file mode 100644 index 0000000..e128cf3 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/decimal.go @@ -0,0 +1,500 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate stringer -type RoundingMode + +package number + +import ( + "math" + "strconv" +) + +// RoundingMode determines how a number is rounded to the desired precision. +type RoundingMode byte + +const ( + ToNearestEven RoundingMode = iota // towards the nearest integer, or towards an even number if equidistant. + ToNearestZero // towards the nearest integer, or towards zero if equidistant. + ToNearestAway // towards the nearest integer, or away from zero if equidistant. + ToPositiveInf // towards infinity + ToNegativeInf // towards negative infinity + ToZero // towards zero + AwayFromZero // away from zero + numModes +) + +const maxIntDigits = 20 + +// A Decimal represents a floating point number in decimal format. +// Digits represents a number [0, 1.0), and the absolute value represented by +// Decimal is Digits * 10^Exp. Leading and trailing zeros may be omitted and Exp +// may point outside a valid position in Digits. +// +// Examples: +// +// Number Decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 +// 12000 Digits: [1, 2], Exp: 5 +// 12000.00 Digits: [1, 2], Exp: 5 +// 0.00123 Digits: [1, 2, 3], Exp: -2 +// 0 Digits: [], Exp: 0 +type Decimal struct { + digits + + buf [maxIntDigits]byte +} + +type digits struct { + Digits []byte // mantissa digits, big-endian + Exp int32 // exponent + Neg bool + Inf bool // Takes precedence over Digits and Exp. + NaN bool // Takes precedence over Inf. +} + +// Digits represents a floating point number represented in digits of the +// base in which a number is to be displayed. It is similar to Decimal, but +// keeps track of trailing fraction zeros and the comma placement for +// engineering notation. Digits must have at least one digit. +// +// Examples: +// +// Number Decimal +// decimal +// 12345 Digits: [1, 2, 3, 4, 5], Exp: 5 End: 5 +// 12.345 Digits: [1, 2, 3, 4, 5], Exp: 2 End: 5 +// 12000 Digits: [1, 2], Exp: 5 End: 5 +// 12000.00 Digits: [1, 2], Exp: 5 End: 7 +// 0.00123 Digits: [1, 2, 3], Exp: -2 End: 3 +// 0 Digits: [], Exp: 0 End: 1 +// scientific (actual exp is Exp - Comma) +// 0e0 Digits: [0], Exp: 1, End: 1, Comma: 1 +// .0e0 Digits: [0], Exp: 0, End: 1, Comma: 0 +// 0.0e0 Digits: [0], Exp: 1, End: 2, Comma: 1 +// 1.23e4 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 1 +// .123e5 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 0 +// engineering +// 12.3e3 Digits: [1, 2, 3], Exp: 5, End: 3, Comma: 2 +type Digits struct { + digits + // End indicates the end position of the number. + End int32 // For decimals Exp <= End. For scientific len(Digits) <= End. + // Comma is used for the comma position for scientific (always 0 or 1) and + // engineering notation (always 0, 1, 2, or 3). + Comma uint8 + // IsScientific indicates whether this number is to be rendered as a + // scientific number. + IsScientific bool +} + +func (d *Digits) NumFracDigits() int { + if d.Exp >= d.End { + return 0 + } + return int(d.End - d.Exp) +} + +// normalize returns a new Decimal with leading and trailing zeros removed. +func (d *Decimal) normalize() (n Decimal) { + n = *d + b := n.Digits + // Strip leading zeros. Resulting number of digits is significant digits. + for len(b) > 0 && b[0] == 0 { + b = b[1:] + n.Exp-- + } + // Strip trailing zeros + for len(b) > 0 && b[len(b)-1] == 0 { + b = b[:len(b)-1] + } + if len(b) == 0 { + n.Exp = 0 + } + n.Digits = b + return n +} + +func (d *Decimal) clear() { + b := d.Digits + if b == nil { + b = d.buf[:0] + } + *d = Decimal{} + d.Digits = b[:0] +} + +func (x *Decimal) String() string { + if x.NaN { + return "NaN" + } + var buf []byte + if x.Neg { + buf = append(buf, '-') + } + if x.Inf { + buf = append(buf, "Inf"...) + return string(buf) + } + switch { + case len(x.Digits) == 0: + buf = append(buf, '0') + case x.Exp <= 0: + // 0.00ddd + buf = append(buf, "0."...) + buf = appendZeros(buf, -int(x.Exp)) + buf = appendDigits(buf, x.Digits) + + case /* 0 < */ int(x.Exp) < len(x.Digits): + // dd.ddd + buf = appendDigits(buf, x.Digits[:x.Exp]) + buf = append(buf, '.') + buf = appendDigits(buf, x.Digits[x.Exp:]) + + default: // len(x.Digits) <= x.Exp + // ddd00 + buf = appendDigits(buf, x.Digits) + buf = appendZeros(buf, int(x.Exp)-len(x.Digits)) + } + return string(buf) +} + +func appendDigits(buf []byte, digits []byte) []byte { + for _, c := range digits { + buf = append(buf, c+'0') + } + return buf +} + +// appendZeros appends n 0 digits to buf and returns buf. +func appendZeros(buf []byte, n int) []byte { + for ; n > 0; n-- { + buf = append(buf, '0') + } + return buf +} + +func (d *digits) round(mode RoundingMode, n int) { + if n >= len(d.Digits) { + return + } + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + inc := false + switch mode { + case ToNegativeInf: + inc = d.Neg + case ToPositiveInf: + inc = !d.Neg + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && + (len(d.Digits) > n+1 || n == 0 || d.Digits[n-1]&1 != 0) + case ToNearestAway: + inc = d.Digits[n] >= 5 + case ToNearestZero: + inc = d.Digits[n] > 5 || d.Digits[n] == 5 && len(d.Digits) > n+1 + default: + panic("unreachable") + } + if inc { + d.roundUp(n) + } else { + d.roundDown(n) + } +} + +// roundFloat rounds a floating point number. +func (r RoundingMode) roundFloat(x float64) float64 { + // Make rounding decision: The result mantissa is truncated ("rounded down") + // by default. Decide if we need to increment, or "round up", the (unsigned) + // mantissa. + abs := x + if x < 0 { + abs = -x + } + i, f := math.Modf(abs) + if f == 0.0 { + return x + } + inc := false + switch r { + case ToNegativeInf: + inc = x < 0 + case ToPositiveInf: + inc = x >= 0 + case ToZero: + // nothing to do + case AwayFromZero: + inc = true + case ToNearestEven: + // TODO: check overflow + inc = f > 0.5 || f == 0.5 && int64(i)&1 != 0 + case ToNearestAway: + inc = f >= 0.5 + case ToNearestZero: + inc = f > 0.5 + default: + panic("unreachable") + } + if inc { + i += 1 + } + if abs != x { + i = -i + } + return i +} + +func (x *digits) roundUp(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + // find first digit < 9 + for n > 0 && x.Digits[n-1] >= 9 { + n-- + } + + if n == 0 { + // all digits are 9s => round up to 1 and update exponent + x.Digits[0] = 1 // ok since len(x.Digits) > n + x.Digits = x.Digits[:1] + x.Exp++ + return + } + x.Digits[n-1]++ + x.Digits = x.Digits[:n] + // x already trimmed +} + +func (x *digits) roundDown(n int) { + if n < 0 || n >= len(x.Digits) { + return // nothing to do + } + x.Digits = x.Digits[:n] + trim(x) +} + +// trim cuts off any trailing zeros from x's mantissa; +// they are meaningless for the value of x. +func trim(x *digits) { + i := len(x.Digits) + for i > 0 && x.Digits[i-1] == 0 { + i-- + } + x.Digits = x.Digits[:i] + if i == 0 { + x.Exp = 0 + } +} + +// A Converter converts a number into decimals according to the given rounding +// criteria. +type Converter interface { + Convert(d *Decimal, r RoundingContext) +} + +const ( + signed = true + unsigned = false +) + +// Convert converts the given number to the decimal representation using the +// supplied RoundingContext. +func (d *Decimal) Convert(r RoundingContext, number interface{}) { + switch f := number.(type) { + case Converter: + d.clear() + f.Convert(d, r) + case float32: + d.ConvertFloat(r, float64(f), 32) + case float64: + d.ConvertFloat(r, f, 64) + case int: + d.ConvertInt(r, signed, uint64(f)) + case int8: + d.ConvertInt(r, signed, uint64(f)) + case int16: + d.ConvertInt(r, signed, uint64(f)) + case int32: + d.ConvertInt(r, signed, uint64(f)) + case int64: + d.ConvertInt(r, signed, uint64(f)) + case uint: + d.ConvertInt(r, unsigned, uint64(f)) + case uint8: + d.ConvertInt(r, unsigned, uint64(f)) + case uint16: + d.ConvertInt(r, unsigned, uint64(f)) + case uint32: + d.ConvertInt(r, unsigned, uint64(f)) + case uint64: + d.ConvertInt(r, unsigned, f) + + default: + d.NaN = true + // TODO: + // case string: if produced by strconv, allows for easy arbitrary pos. + // case reflect.Value: + // case big.Float + // case big.Int + // case big.Rat? + // catch underlyings using reflect or will this already be done by the + // message package? + } +} + +// ConvertInt converts an integer to decimals. +func (d *Decimal) ConvertInt(r RoundingContext, signed bool, x uint64) { + if r.Increment > 0 { + // TODO: if uint64 is too large, fall back to float64 + if signed { + d.ConvertFloat(r, float64(int64(x)), 64) + } else { + d.ConvertFloat(r, float64(x), 64) + } + return + } + d.clear() + if signed && int64(x) < 0 { + x = uint64(-int64(x)) + d.Neg = true + } + d.fillIntDigits(x) + d.Exp = int32(len(d.Digits)) +} + +// ConvertFloat converts a floating point number to decimals. +func (d *Decimal) ConvertFloat(r RoundingContext, x float64, size int) { + d.clear() + if math.IsNaN(x) { + d.NaN = true + return + } + // Simple case: decimal notation + if r.Increment > 0 { + scale := int(r.IncrementScale) + mult := 1.0 + if scale >= len(scales) { + mult = math.Pow(10, float64(scale)) + } else { + mult = scales[scale] + } + // We multiply x instead of dividing inc as it gives less rounding + // issues. + x *= mult + x /= float64(r.Increment) + x = r.Mode.roundFloat(x) + x *= float64(r.Increment) + x /= mult + } + + abs := x + if x < 0 { + d.Neg = true + abs = -x + } + if math.IsInf(abs, 1) { + d.Inf = true + return + } + + // By default we get the exact decimal representation. + verb := byte('g') + prec := -1 + // As the strconv API does not return the rounding accuracy, we can only + // round using ToNearestEven. + if r.Mode == ToNearestEven { + if n := r.RoundSignificantDigits(); n >= 0 { + prec = n + } else if n = r.RoundFractionDigits(); n >= 0 { + prec = n + verb = 'f' + } + } else { + // TODO: At this point strconv's rounding is imprecise to the point that + // it is not usable for this purpose. + // See https://github.com/golang/go/issues/21714 + // If rounding is requested, we ask for a large number of digits and + // round from there to simulate rounding only once. + // Ideally we would have strconv export an AppendDigits that would take + // a rounding mode and/or return an accuracy. Something like this would + // work: + // AppendDigits(dst []byte, x float64, base, size, prec int) (digits []byte, exp, accuracy int) + hasPrec := r.RoundSignificantDigits() >= 0 + hasScale := r.RoundFractionDigits() >= 0 + if hasPrec || hasScale { + // prec is the number of mantissa bits plus some extra for safety. + // We need at least the number of mantissa bits as decimals to + // accurately represent the floating point without rounding, as each + // bit requires one more decimal to represent: 0.5, 0.25, 0.125, ... + prec = 60 + } + } + + b := strconv.AppendFloat(d.Digits[:0], abs, verb, prec, size) + i := 0 + k := 0 + beforeDot := 1 + for i < len(b) { + if c := b[i]; '0' <= c && c <= '9' { + b[k] = c - '0' + k++ + d.Exp += int32(beforeDot) + } else if c == '.' { + beforeDot = 0 + d.Exp = int32(k) + } else { + break + } + i++ + } + d.Digits = b[:k] + if i != len(b) { + i += len("e") + pSign := i + exp := 0 + for i++; i < len(b); i++ { + exp *= 10 + exp += int(b[i] - '0') + } + if b[pSign] == '-' { + exp = -exp + } + d.Exp = int32(exp) + 1 + } +} + +func (d *Decimal) fillIntDigits(x uint64) { + if cap(d.Digits) < maxIntDigits { + d.Digits = d.buf[:] + } else { + d.Digits = d.buf[:maxIntDigits] + } + i := 0 + for ; x > 0; x /= 10 { + d.Digits[i] = byte(x % 10) + i++ + } + d.Digits = d.Digits[:i] + for p := 0; p < i; p++ { + i-- + d.Digits[p], d.Digits[i] = d.Digits[i], d.Digits[p] + } +} + +var scales [70]float64 + +func init() { + x := 1.0 + for i := range scales { + scales[i] = x + x *= 10 + } +} diff --git a/vendor/golang.org/x/text/internal/number/format.go b/vendor/golang.org/x/text/internal/number/format.go new file mode 100644 index 0000000..1aadcf4 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/format.go @@ -0,0 +1,533 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "strconv" + "unicode/utf8" + + "golang.org/x/text/language" +) + +// TODO: +// - grouping of fractions +// - allow user-defined superscript notation (such as 4) +// - same for non-breaking spaces, like   + +// A VisibleDigits computes digits, comma placement and trailing zeros as they +// will be shown to the user. +type VisibleDigits interface { + Digits(buf []byte, t language.Tag, scale int) Digits + // TODO: Do we also need to add the verb or pass a format.State? +} + +// Formatting proceeds along the following lines: +// 0) Compose rounding information from format and context. +// 1) Convert a number into a Decimal. +// 2) Sanitize Decimal by adding trailing zeros, removing leading digits, and +// (non-increment) rounding. The Decimal that results from this is suitable +// for determining the plural form. +// 3) Render the Decimal in the localized form. + +// Formatter contains all the information needed to render a number. +type Formatter struct { + Pattern + Info +} + +func (f *Formatter) init(t language.Tag, index []uint8) { + f.Info = InfoFromTag(t) + f.Pattern = formats[index[tagToID(t)]] +} + +// InitPattern initializes a Formatter for the given Pattern. +func (f *Formatter) InitPattern(t language.Tag, pat *Pattern) { + f.Info = InfoFromTag(t) + f.Pattern = *pat +} + +// InitDecimal initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitDecimal(t language.Tag) { + f.init(t, tagToDecimal) +} + +// InitScientific initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitScientific(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 +} + +// InitEngineering initializes a Formatter using the default Pattern for the +// given language. +func (f *Formatter) InitEngineering(t language.Tag) { + f.init(t, tagToScientific) + f.Pattern.MinFractionDigits = 0 + f.Pattern.MaxFractionDigits = -1 + f.Pattern.MaxIntegerDigits = 3 + f.Pattern.MinIntegerDigits = 1 +} + +// InitPercent initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPercent(t language.Tag) { + f.init(t, tagToPercent) +} + +// InitPerMille initializes a Formatter using the default Pattern for the given +// language. +func (f *Formatter) InitPerMille(t language.Tag) { + f.init(t, tagToPercent) + f.Pattern.DigitShift = 3 +} + +func (f *Formatter) Append(dst []byte, x interface{}) []byte { + var d Decimal + r := f.RoundingContext + d.Convert(r, x) + return f.Render(dst, FormatDigits(&d, r)) +} + +func FormatDigits(d *Decimal, r RoundingContext) Digits { + if r.isScientific() { + return scientificVisibleDigits(r, d) + } + return decimalVisibleDigits(r, d) +} + +func (f *Formatter) Format(dst []byte, d *Decimal) []byte { + return f.Render(dst, FormatDigits(d, f.RoundingContext)) +} + +func (f *Formatter) Render(dst []byte, d Digits) []byte { + var result []byte + var postPrefix, preSuffix int + if d.IsScientific { + result, postPrefix, preSuffix = appendScientific(dst, f, &d) + } else { + result, postPrefix, preSuffix = appendDecimal(dst, f, &d) + } + if f.PadRune == 0 { + return result + } + width := int(f.FormatWidth) + if count := utf8.RuneCount(result); count < width { + insertPos := 0 + switch f.Flags & PadMask { + case PadAfterPrefix: + insertPos = postPrefix + case PadBeforeSuffix: + insertPos = preSuffix + case PadAfterSuffix: + insertPos = len(result) + } + num := width - count + pad := [utf8.UTFMax]byte{' '} + sz := 1 + if r := f.PadRune; r != 0 { + sz = utf8.EncodeRune(pad[:], r) + } + extra := sz * num + if n := len(result) + extra; n < cap(result) { + result = result[:n] + copy(result[insertPos+extra:], result[insertPos:]) + } else { + buf := make([]byte, n) + copy(buf, result[:insertPos]) + copy(buf[insertPos+extra:], result[insertPos:]) + result = buf + } + for ; num > 0; num-- { + insertPos += copy(result[insertPos:], pad[:sz]) + } + } + return result +} + +// decimalVisibleDigits converts d according to the RoundingContext. Note that +// the exponent may change as a result of this operation. +func decimalVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits} + + exp := n.Exp + exp += int32(r.DigitShift) + + // Cap integer digits. Remove *most-significant* digits. + if r.MaxIntegerDigits > 0 { + if p := int(exp) - int(r.MaxIntegerDigits); p > 0 { + if p > len(n.Digits) { + p = len(n.Digits) + } + if n.Digits = n.Digits[p:]; len(n.Digits) == 0 { + exp = 0 + } else { + exp -= int32(p) + } + // Strip leading zeros. + for len(n.Digits) > 0 && n.Digits[0] == 0 { + n.Digits = n.Digits[1:] + exp-- + } + } + } + + // Rounding if not already done by Convert. + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 { + if cap := int(exp) + maxFrac; cap < p { + p = int(exp) + maxFrac + } + if p < 0 { + p = 0 + } + } + n.round(r.Mode, p) + + // set End (trailing zeros) + n.End = int32(len(n.Digits)) + if n.End == 0 { + exp = 0 + if r.MinFractionDigits > 0 { + n.End = int32(r.MinFractionDigits) + } + if p := int32(r.MinSignificantDigits) - 1; p > n.End { + n.End = p + } + } else { + if end := exp + int32(r.MinFractionDigits); end > n.End { + n.End = end + } + if n.End < int32(r.MinSignificantDigits) { + n.End = int32(r.MinSignificantDigits) + } + } + n.Exp = exp + return n +} + +// appendDecimal appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendDecimal(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, len(dst) + } + digits := n.Digits + exp := n.Exp + + // Split in integer and fraction part. + var intDigits, fracDigits []byte + numInt := 0 + numFrac := int(n.End - n.Exp) + if exp > 0 { + numInt = int(exp) + if int(exp) >= len(digits) { // ddddd | ddddd00 + intDigits = digits + } else { // ddd.dd + intDigits = digits[:exp] + fracDigits = digits[exp:] + } + } else { + fracDigits = digits + } + + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + minInt := int(f.MinIntegerDigits) + if minInt == 0 && f.MinSignificantDigits > 0 { + minInt = 1 + } + // add leading zeros + for i := minInt; i > numInt; i-- { + dst = f.AppendDigit(dst, 0) + if f.needsSep(i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + // Add trailing zeros + i = 0 + for n := -int(n.Exp); i < n; i++ { + dst = f.AppendDigit(dst, 0) + } + for _, d := range fracDigits { + i++ + dst = f.AppendDigit(dst, d) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +func scientificVisibleDigits(r RoundingContext, d *Decimal) Digits { + if d.NaN || d.Inf { + return Digits{digits: digits{Neg: d.Neg, NaN: d.NaN, Inf: d.Inf}} + } + n := Digits{digits: d.normalize().digits, IsScientific: true} + + // Normalize to have at least one digit. This simplifies engineering + // notation. + if len(n.Digits) == 0 { + n.Digits = append(n.Digits, 0) + n.Exp = 1 + } + + // Significant digits are transformed by the parser for scientific notation + // and do not need to be handled here. + maxInt, numInt := int(r.MaxIntegerDigits), int(r.MinIntegerDigits) + if numInt == 0 { + numInt = 1 + } + + // If a maximum number of integers is specified, the minimum must be 1 + // and the exponent is grouped by this number (e.g. for engineering) + if maxInt > numInt { + // Correct the exponent to reflect a single integer digit. + numInt = 1 + // engineering + // 0.01234 ([12345]e-1) -> 1.2345e-2 12.345e-3 + // 12345 ([12345]e+5) -> 1.2345e4 12.345e3 + d := int(n.Exp-1) % maxInt + if d < 0 { + d += maxInt + } + numInt += d + } + + p := len(n.Digits) + if maxSig := int(r.MaxSignificantDigits); maxSig > 0 { + p = maxSig + } + if maxFrac := int(r.MaxFractionDigits); maxFrac >= 0 && numInt+maxFrac < p { + p = numInt + maxFrac + } + n.round(r.Mode, p) + + n.Comma = uint8(numInt) + n.End = int32(len(n.Digits)) + if minSig := int32(r.MinFractionDigits) + int32(numInt); n.End < minSig { + n.End = minSig + } + return n +} + +// appendScientific appends a formatted number to dst. It returns two possible +// insertion points for padding. +func appendScientific(dst []byte, f *Formatter, n *Digits) (b []byte, postPre, preSuf int) { + if dst, ok := f.renderSpecial(dst, n); ok { + return dst, 0, 0 + } + digits := n.Digits + numInt := int(n.Comma) + numFrac := int(n.End) - int(n.Comma) + + var intDigits, fracDigits []byte + if numInt <= len(digits) { + intDigits = digits[:numInt] + fracDigits = digits[numInt:] + } else { + intDigits = digits + } + neg := n.Neg + affix, suffix := f.getAffixes(neg) + dst = appendAffix(dst, f, affix, neg) + savedLen := len(dst) + + i := 0 + for ; i < len(intDigits); i++ { + dst = f.AppendDigit(dst, intDigits[i]) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + for ; i < numInt; i++ { + dst = f.AppendDigit(dst, 0) + if f.needsSep(numInt - i) { + dst = append(dst, f.Symbol(SymGroup)...) + } + } + + if numFrac > 0 || f.Flags&AlwaysDecimalSeparator != 0 { + dst = append(dst, f.Symbol(SymDecimal)...) + } + i = 0 + for ; i < len(fracDigits); i++ { + dst = f.AppendDigit(dst, fracDigits[i]) + } + for ; i < numFrac; i++ { + dst = f.AppendDigit(dst, 0) + } + + // exp + buf := [12]byte{} + // TODO: use exponential if superscripting is not available (no Latin + // numbers or no tags) and use exponential in all other cases. + exp := n.Exp - int32(n.Comma) + exponential := f.Symbol(SymExponential) + if exponential == "E" { + dst = append(dst, f.Symbol(SymSuperscriptingExponent)...) + dst = f.AppendDigit(dst, 1) + dst = f.AppendDigit(dst, 0) + switch { + case exp < 0: + dst = append(dst, superMinus...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, superPlus...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = append(dst, superDigits[0]...) + } + for _, c := range b { + dst = append(dst, superDigits[c-'0']...) + } + } else { + dst = append(dst, exponential...) + switch { + case exp < 0: + dst = append(dst, f.Symbol(SymMinusSign)...) + exp = -exp + case f.Flags&AlwaysExpSign != 0: + dst = append(dst, f.Symbol(SymPlusSign)...) + } + b = strconv.AppendUint(buf[:0], uint64(exp), 10) + for i := len(b); i < int(f.MinExponentDigits); i++ { + dst = f.AppendDigit(dst, 0) + } + for _, c := range b { + dst = f.AppendDigit(dst, c-'0') + } + } + return appendAffix(dst, f, suffix, neg), savedLen, len(dst) +} + +const ( + superMinus = "\u207B" // SUPERSCRIPT HYPHEN-MINUS + superPlus = "\u207A" // SUPERSCRIPT PLUS SIGN +) + +var ( + // Note: the digits are not sequential!!! + superDigits = []string{ + "\u2070", // SUPERSCRIPT DIGIT ZERO + "\u00B9", // SUPERSCRIPT DIGIT ONE + "\u00B2", // SUPERSCRIPT DIGIT TWO + "\u00B3", // SUPERSCRIPT DIGIT THREE + "\u2074", // SUPERSCRIPT DIGIT FOUR + "\u2075", // SUPERSCRIPT DIGIT FIVE + "\u2076", // SUPERSCRIPT DIGIT SIX + "\u2077", // SUPERSCRIPT DIGIT SEVEN + "\u2078", // SUPERSCRIPT DIGIT EIGHT + "\u2079", // SUPERSCRIPT DIGIT NINE + } +) + +func (f *Formatter) getAffixes(neg bool) (affix, suffix string) { + str := f.Affix + if str != "" { + if f.NegOffset > 0 { + if neg { + str = str[f.NegOffset:] + } else { + str = str[:f.NegOffset] + } + } + sufStart := 1 + str[0] + affix = str[1:sufStart] + suffix = str[sufStart+1:] + } + // TODO: introduce a NeedNeg sign to indicate if the left pattern already + // has a sign marked? + if f.NegOffset == 0 && (neg || f.Flags&AlwaysSign != 0) { + affix = "-" + affix + } + return affix, suffix +} + +func (f *Formatter) renderSpecial(dst []byte, d *Digits) (b []byte, ok bool) { + if d.NaN { + return fmtNaN(dst, f), true + } + if d.Inf { + return fmtInfinite(dst, f, d), true + } + return dst, false +} + +func fmtNaN(dst []byte, f *Formatter) []byte { + return append(dst, f.Symbol(SymNan)...) +} + +func fmtInfinite(dst []byte, f *Formatter, d *Digits) []byte { + affix, suffix := f.getAffixes(d.Neg) + dst = appendAffix(dst, f, affix, d.Neg) + dst = append(dst, f.Symbol(SymInfinity)...) + dst = appendAffix(dst, f, suffix, d.Neg) + return dst +} + +func appendAffix(dst []byte, f *Formatter, affix string, neg bool) []byte { + quoting := false + escaping := false + for _, r := range affix { + switch { + case escaping: + // escaping occurs both inside and outside of quotes + dst = append(dst, string(r)...) + escaping = false + case r == '\\': + escaping = true + case r == '\'': + quoting = !quoting + case quoting: + dst = append(dst, string(r)...) + case r == '%': + if f.DigitShift == 3 { + dst = append(dst, f.Symbol(SymPerMille)...) + } else { + dst = append(dst, f.Symbol(SymPercentSign)...) + } + case r == '-' || r == '+': + if neg { + dst = append(dst, f.Symbol(SymMinusSign)...) + } else if f.Flags&ElideSign == 0 { + dst = append(dst, f.Symbol(SymPlusSign)...) + } else { + dst = append(dst, ' ') + } + default: + dst = append(dst, string(r)...) + } + } + return dst +} diff --git a/vendor/golang.org/x/text/internal/number/number.go b/vendor/golang.org/x/text/internal/number/number.go new file mode 100644 index 0000000..e1d933c --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/number.go @@ -0,0 +1,152 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go + +// Package number contains tools and data for formatting numbers. +package number + +import ( + "unicode/utf8" + + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/language" +) + +// Info holds number formatting configuration data. +type Info struct { + system systemData // numbering system information + symIndex symOffset // index to symbols +} + +// InfoFromLangID returns a Info for the given compact language identifier and +// numbering system identifier. If system is the empty string, the default +// numbering system will be taken for that language. +func InfoFromLangID(compactIndex compact.ID, numberSystem string) Info { + p := langToDefaults[compactIndex] + // Lookup the entry for the language. + pSymIndex := symOffset(0) // Default: Latin, default symbols + system, ok := systemMap[numberSystem] + if !ok { + // Take the value for the default numbering system. This is by far the + // most common case as an alternative numbering system is hardly used. + if p&hasNonLatnMask == 0 { // Latn digits. + pSymIndex = p + } else { // Non-Latn or multiple numbering systems. + // Take the first entry from the alternatives list. + data := langToAlt[p&^hasNonLatnMask] + pSymIndex = data.symIndex + system = data.system + } + } else { + langIndex := compactIndex + ns := system + outerLoop: + for ; ; p = langToDefaults[langIndex] { + if p&hasNonLatnMask == 0 { + if ns == 0 { + // The index directly points to the symbol data. + pSymIndex = p + break + } + // Move to the parent and retry. + langIndex = langIndex.Parent() + } else { + // The index points to a list of symbol data indexes. + for _, e := range langToAlt[p&^hasNonLatnMask:] { + if e.compactTag != langIndex { + if langIndex == 0 { + // The CLDR root defines full symbol information for + // all numbering systems (even though mostly by + // means of aliases). Fall back to the default entry + // for Latn if there is no data for the numbering + // system of this language. + if ns == 0 { + break + } + // Fall back to Latin and start from the original + // language. See + // https://unicode.org/reports/tr35/#Locale_Inheritance. + ns = numLatn + langIndex = compactIndex + continue outerLoop + } + // Fall back to parent. + langIndex = langIndex.Parent() + } else if e.system == ns { + pSymIndex = e.symIndex + break outerLoop + } + } + } + } + } + if int(system) >= len(numSysData) { // algorithmic + // Will generate ASCII digits in case the user inadvertently calls + // WriteDigit or Digit on it. + d := numSysData[0] + d.id = system + return Info{ + system: d, + symIndex: pSymIndex, + } + } + return Info{ + system: numSysData[system], + symIndex: pSymIndex, + } +} + +// InfoFromTag returns a Info for the given language tag. +func InfoFromTag(t language.Tag) Info { + return InfoFromLangID(tagToID(t), t.TypeForKey("nu")) +} + +// IsDecimal reports if the numbering system can convert decimal to native +// symbols one-to-one. +func (n Info) IsDecimal() bool { + return int(n.system.id) < len(numSysData) +} + +// WriteDigit writes the UTF-8 sequence for n corresponding to the given ASCII +// digit to dst and reports the number of bytes written. dst must be large +// enough to hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) WriteDigit(dst []byte, asciiDigit rune) int { + copy(dst, n.system.zero[:n.system.digitSize]) + dst[n.system.digitSize-1] += byte(asciiDigit - '0') + return int(n.system.digitSize) +} + +// AppendDigit appends the UTF-8 sequence for n corresponding to the given digit +// to dst and reports the number of bytes written. dst must be large enough to +// hold the rune (can be up to utf8.UTFMax bytes). +func (n Info) AppendDigit(dst []byte, digit byte) []byte { + dst = append(dst, n.system.zero[:n.system.digitSize]...) + dst[len(dst)-1] += digit + return dst +} + +// Digit returns the digit for the numbering system for the corresponding ASCII +// value. For example, ni.Digit('3') could return '三'. Note that the argument +// is the rune constant '3', which equals 51, not the integer constant 3. +func (n Info) Digit(asciiDigit rune) rune { + var x [utf8.UTFMax]byte + n.WriteDigit(x[:], asciiDigit) + r, _ := utf8.DecodeRune(x[:]) + return r +} + +// Symbol returns the string for the given symbol type. +func (n Info) Symbol(t SymbolType) string { + return symData.Elem(int(symIndex[n.symIndex][t])) +} + +func formatForLang(t language.Tag, index []byte) *Pattern { + return &formats[index[tagToID(t)]] +} + +func tagToID(t language.Tag) compact.ID { + id, _ := compact.RegionalID(compact.Tag(t)) + return id +} diff --git a/vendor/golang.org/x/text/internal/number/pattern.go b/vendor/golang.org/x/text/internal/number/pattern.go new file mode 100644 index 0000000..06e5955 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/pattern.go @@ -0,0 +1,485 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package number + +import ( + "errors" + "unicode/utf8" +) + +// This file contains a parser for the CLDR number patterns as described in +// https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +// +// The following BNF is derived from this standard. +// +// pattern := subpattern (';' subpattern)? +// subpattern := affix? number exponent? affix? +// number := decimal | sigDigits +// decimal := '#'* '0'* ('.' fraction)? | '#' | '0' +// fraction := '0'* '#'* +// sigDigits := '#'* '@' '@'* '#'* +// exponent := 'E' '+'? '0'* '0' +// padSpec := '*' \L +// +// Notes: +// - An affix pattern may contain any runes, but runes with special meaning +// should be escaped. +// - Sequences of digits, '#', and '@' in decimal and sigDigits may have +// interstitial commas. + +// TODO: replace special characters in affixes (-, +, ¤) with control codes. + +// Pattern holds information for formatting numbers. It is designed to hold +// information from CLDR number patterns. +// +// This pattern is precompiled for all patterns for all languages. Even though +// the number of patterns is not very large, we want to keep this small. +// +// This type is only intended for internal use. +type Pattern struct { + RoundingContext + + Affix string // includes prefix and suffix. First byte is prefix length. + Offset uint16 // Offset into Affix for prefix and suffix + NegOffset uint16 // Offset into Affix for negative prefix and suffix or 0. + PadRune rune + FormatWidth uint16 + + GroupingSize [2]uint8 + Flags PatternFlag +} + +// A RoundingContext indicates how a number should be converted to digits. +// It contains all information needed to determine the "visible digits" as +// required by the pluralization rules. +type RoundingContext struct { + // TODO: unify these two fields so that there is a more unambiguous meaning + // of how precision is handled. + MaxSignificantDigits int16 // -1 is unlimited + MaxFractionDigits int16 // -1 is unlimited + + Increment uint32 + IncrementScale uint8 // May differ from printed scale. + + Mode RoundingMode + + DigitShift uint8 // Number of decimals to shift. Used for % and ‰. + + // Number of digits. + MinIntegerDigits uint8 + + MaxIntegerDigits uint8 + MinFractionDigits uint8 + MinSignificantDigits uint8 + + MinExponentDigits uint8 +} + +// RoundSignificantDigits returns the number of significant digits an +// implementation of Convert may round to or n < 0 if there is no maximum or +// a maximum is not recommended. +func (r *RoundingContext) RoundSignificantDigits() (n int) { + if r.MaxFractionDigits == 0 && r.MaxSignificantDigits > 0 { + return int(r.MaxSignificantDigits) + } else if r.isScientific() && r.MaxIntegerDigits == 1 { + if r.MaxSignificantDigits == 0 || + int(r.MaxFractionDigits+1) == int(r.MaxSignificantDigits) { + // Note: don't add DigitShift: it is only used for decimals. + return int(r.MaxFractionDigits) + 1 + } + } + return -1 +} + +// RoundFractionDigits returns the number of fraction digits an implementation +// of Convert may round to or n < 0 if there is no maximum or a maximum is not +// recommended. +func (r *RoundingContext) RoundFractionDigits() (n int) { + if r.MinExponentDigits == 0 && + r.MaxSignificantDigits == 0 && + r.MaxFractionDigits >= 0 { + return int(r.MaxFractionDigits) + int(r.DigitShift) + } + return -1 +} + +// SetScale fixes the RoundingContext to a fixed number of fraction digits. +func (r *RoundingContext) SetScale(scale int) { + r.MinFractionDigits = uint8(scale) + r.MaxFractionDigits = int16(scale) +} + +func (r *RoundingContext) SetPrecision(prec int) { + r.MaxSignificantDigits = int16(prec) +} + +func (r *RoundingContext) isScientific() bool { + return r.MinExponentDigits > 0 +} + +func (f *Pattern) needsSep(pos int) bool { + p := pos - 1 + size := int(f.GroupingSize[0]) + if size == 0 || p == 0 { + return false + } + if p == size { + return true + } + if p -= size; p < 0 { + return false + } + // TODO: make second groupingsize the same as first if 0 so that we can + // avoid this check. + if x := int(f.GroupingSize[1]); x != 0 { + size = x + } + return p%size == 0 +} + +// A PatternFlag is a bit mask for the flag field of a Pattern. +type PatternFlag uint8 + +const ( + AlwaysSign PatternFlag = 1 << iota + ElideSign // Use space instead of plus sign. AlwaysSign must be true. + AlwaysExpSign + AlwaysDecimalSeparator + ParenthesisForNegative // Common pattern. Saves space. + + PadAfterNumber + PadAfterAffix + + PadBeforePrefix = 0 // Default + PadAfterPrefix = PadAfterAffix + PadBeforeSuffix = PadAfterNumber + PadAfterSuffix = PadAfterNumber | PadAfterAffix + PadMask = PadAfterNumber | PadAfterAffix +) + +type parser struct { + *Pattern + + leadingSharps int + + pos int + err error + doNotTerminate bool + groupingCount uint + hasGroup bool + buf []byte +} + +func (p *parser) setError(err error) { + if p.err == nil { + p.err = err + } +} + +func (p *parser) updateGrouping() { + if p.hasGroup && + 0 < p.groupingCount && p.groupingCount < 255 { + p.GroupingSize[1] = p.GroupingSize[0] + p.GroupingSize[0] = uint8(p.groupingCount) + } + p.groupingCount = 0 + p.hasGroup = true +} + +var ( + // TODO: more sensible and localizeable error messages. + errMultiplePadSpecifiers = errors.New("format: pattern has multiple pad specifiers") + errInvalidPadSpecifier = errors.New("format: invalid pad specifier") + errInvalidQuote = errors.New("format: invalid quote") + errAffixTooLarge = errors.New("format: prefix or suffix exceeds maximum UTF-8 length of 256 bytes") + errDuplicatePercentSign = errors.New("format: duplicate percent sign") + errDuplicatePermilleSign = errors.New("format: duplicate permille sign") + errUnexpectedEnd = errors.New("format: unexpected end of pattern") +) + +// ParsePattern extracts formatting information from a CLDR number pattern. +// +// See https://unicode.org/reports/tr35/tr35-numbers.html#Number_Format_Patterns. +func ParsePattern(s string) (f *Pattern, err error) { + p := parser{Pattern: &Pattern{}} + + s = p.parseSubPattern(s) + + if s != "" { + // Parse negative sub pattern. + if s[0] != ';' { + p.setError(errors.New("format: error parsing first sub pattern")) + return nil, p.err + } + neg := parser{Pattern: &Pattern{}} // just for extracting the affixes. + s = neg.parseSubPattern(s[len(";"):]) + p.NegOffset = uint16(len(p.buf)) + p.buf = append(p.buf, neg.buf...) + } + if s != "" { + p.setError(errors.New("format: spurious characters at end of pattern")) + } + if p.err != nil { + return nil, p.err + } + if affix := string(p.buf); affix == "\x00\x00" || affix == "\x00\x00\x00\x00" { + // No prefix or suffixes. + p.NegOffset = 0 + } else { + p.Affix = affix + } + if p.Increment == 0 { + p.IncrementScale = 0 + } + return p.Pattern, nil +} + +func (p *parser) parseSubPattern(s string) string { + s = p.parsePad(s, PadBeforePrefix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterPrefix) + + s = p.parse(p.number, s) + p.updateGrouping() + + s = p.parsePad(s, PadBeforeSuffix) + s = p.parseAffix(s) + s = p.parsePad(s, PadAfterSuffix) + return s +} + +func (p *parser) parsePad(s string, f PatternFlag) (tail string) { + if len(s) >= 2 && s[0] == '*' { + r, sz := utf8.DecodeRuneInString(s[1:]) + if p.PadRune != 0 { + p.err = errMultiplePadSpecifiers + } else { + p.Flags |= f + p.PadRune = r + } + return s[1+sz:] + } + return s +} + +func (p *parser) parseAffix(s string) string { + x := len(p.buf) + p.buf = append(p.buf, 0) // placeholder for affix length + + s = p.parse(p.affix, s) + + n := len(p.buf) - x - 1 + if n > 0xFF { + p.setError(errAffixTooLarge) + } + p.buf[x] = uint8(n) + return s +} + +// state implements a state transition. It returns the new state. A state +// function may set an error on the parser or may simply return on an incorrect +// token and let the next phase fail. +type state func(r rune) state + +// parse repeatedly applies a state function on the given string until a +// termination condition is reached. +func (p *parser) parse(fn state, s string) (tail string) { + for i, r := range s { + p.doNotTerminate = false + if fn = fn(r); fn == nil || p.err != nil { + return s[i:] + } + p.FormatWidth++ + } + if p.doNotTerminate { + p.setError(errUnexpectedEnd) + } + return "" +} + +func (p *parser) affix(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9', + '#', '@', '.', '*', ',', ';': + return nil + case '\'': + p.FormatWidth-- + return p.escapeFirst + case '%': + if p.DigitShift != 0 { + p.setError(errDuplicatePercentSign) + } + p.DigitShift = 2 + case '\u2030': // ‰ Per mille + if p.DigitShift != 0 { + p.setError(errDuplicatePermilleSign) + } + p.DigitShift = 3 + // TODO: handle currency somehow: ¤, ¤¤, ¤¤¤, ¤¤¤¤ + } + p.buf = append(p.buf, string(r)...) + return p.affix +} + +func (p *parser) escapeFirst(r rune) state { + switch r { + case '\'': + p.buf = append(p.buf, "\\'"...) + return p.affix + default: + p.buf = append(p.buf, '\'') + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +func (p *parser) escape(r rune) state { + switch r { + case '\'': + p.FormatWidth-- + p.buf = append(p.buf, '\'') + return p.affix + default: + p.buf = append(p.buf, string(r)...) + } + return p.escape +} + +// number parses a number. The BNF says the integer part should always have +// a '0', but that does not appear to be the case according to the rest of the +// documentation. We will allow having only '#' numbers. +func (p *parser) number(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.leadingSharps++ + case '@': + p.groupingCount++ + p.leadingSharps = 0 + p.MaxFractionDigits = -1 + return p.sigDigits(r) + case ',': + if p.leadingSharps == 0 { // no leading commas + return nil + } + p.updateGrouping() + case 'E': + p.MaxIntegerDigits = uint8(p.leadingSharps) + return p.exponent + case '.': // allow ".##" etc. + p.updateGrouping() + return p.fraction + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + return p.integer(r) + default: + return nil + } + return p.number +} + +func (p *parser) integer(r rune) state { + if !('0' <= r && r <= '9') { + var next state + switch r { + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + next = p.exponent + case '.': + next = p.fraction + case ',': + next = p.integer + } + p.updateGrouping() + return next + } + p.Increment = p.Increment*10 + uint32(r-'0') + p.groupingCount++ + p.MinIntegerDigits++ + return p.integer +} + +func (p *parser) sigDigits(r rune) state { + switch r { + case '@': + p.groupingCount++ + p.MaxSignificantDigits++ + p.MinSignificantDigits++ + case '#': + return p.sigDigitsFinal(r) + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigits +} + +func (p *parser) sigDigitsFinal(r rune) state { + switch r { + case '#': + p.groupingCount++ + p.MaxSignificantDigits++ + case 'E': + p.updateGrouping() + return p.normalizeSigDigitsWithExponent() + default: + p.updateGrouping() + return nil + } + return p.sigDigitsFinal +} + +func (p *parser) normalizeSigDigitsWithExponent() state { + p.MinIntegerDigits, p.MaxIntegerDigits = 1, 1 + p.MinFractionDigits = p.MinSignificantDigits - 1 + p.MaxFractionDigits = p.MaxSignificantDigits - 1 + p.MinSignificantDigits, p.MaxSignificantDigits = 0, 0 + return p.exponent +} + +func (p *parser) fraction(r rune) state { + switch r { + case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': + p.Increment = p.Increment*10 + uint32(r-'0') + p.IncrementScale++ + p.MinFractionDigits++ + p.MaxFractionDigits++ + case '#': + p.MaxFractionDigits++ + case 'E': + if p.leadingSharps > 0 { + p.MaxIntegerDigits = uint8(p.leadingSharps) + p.MinIntegerDigits + } + return p.exponent + default: + return nil + } + return p.fraction +} + +func (p *parser) exponent(r rune) state { + switch r { + case '+': + // Set mode and check it wasn't already set. + if p.Flags&AlwaysExpSign != 0 || p.MinExponentDigits > 0 { + break + } + p.Flags |= AlwaysExpSign + p.doNotTerminate = true + return p.exponent + case '0': + p.MinExponentDigits++ + return p.exponent + } + // termination condition + if p.MinExponentDigits == 0 { + p.setError(errors.New("format: need at least one digit")) + } + return nil +} diff --git a/vendor/golang.org/x/text/internal/number/roundingmode_string.go b/vendor/golang.org/x/text/internal/number/roundingmode_string.go new file mode 100644 index 0000000..bcc2247 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/roundingmode_string.go @@ -0,0 +1,30 @@ +// Code generated by "stringer -type RoundingMode"; DO NOT EDIT. + +package number + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ToNearestEven-0] + _ = x[ToNearestZero-1] + _ = x[ToNearestAway-2] + _ = x[ToPositiveInf-3] + _ = x[ToNegativeInf-4] + _ = x[ToZero-5] + _ = x[AwayFromZero-6] + _ = x[numModes-7] +} + +const _RoundingMode_name = "ToNearestEvenToNearestZeroToNearestAwayToPositiveInfToNegativeInfToZeroAwayFromZeronumModes" + +var _RoundingMode_index = [...]uint8{0, 13, 26, 39, 52, 65, 71, 83, 91} + +func (i RoundingMode) String() string { + if i >= RoundingMode(len(_RoundingMode_index)-1) { + return "RoundingMode(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _RoundingMode_name[_RoundingMode_index[i]:_RoundingMode_index[i+1]] +} diff --git a/vendor/golang.org/x/text/internal/number/tables.go b/vendor/golang.org/x/text/internal/number/tables.go new file mode 100644 index 0000000..8efce81 --- /dev/null +++ b/vendor/golang.org/x/text/internal/number/tables.go @@ -0,0 +1,1219 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package number + +import "golang.org/x/text/internal/stringset" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +var numSysData = []systemData{ // 59 elements + 0: {id: 0x0, digitSize: 0x1, zero: [4]uint8{0x30, 0x0, 0x0, 0x0}}, + 1: {id: 0x1, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9e, 0xa5, 0x90}}, + 2: {id: 0x2, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9c, 0xb0}}, + 3: {id: 0x3, digitSize: 0x2, zero: [4]uint8{0xd9, 0xa0, 0x0, 0x0}}, + 4: {id: 0x4, digitSize: 0x2, zero: [4]uint8{0xdb, 0xb0, 0x0, 0x0}}, + 5: {id: 0x5, digitSize: 0x3, zero: [4]uint8{0xe1, 0xad, 0x90, 0x0}}, + 6: {id: 0x6, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa7, 0xa6, 0x0}}, + 7: {id: 0x7, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb1, 0x90}}, + 8: {id: 0x8, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x81, 0xa6}}, + 9: {id: 0x9, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x84, 0xb6}}, + 10: {id: 0xa, digitSize: 0x3, zero: [4]uint8{0xea, 0xa9, 0x90, 0x0}}, + 11: {id: 0xb, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa5, 0xa6, 0x0}}, + 12: {id: 0xc, digitSize: 0x3, zero: [4]uint8{0xef, 0xbc, 0x90, 0x0}}, + 13: {id: 0xd, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xb5, 0x90}}, + 14: {id: 0xe, digitSize: 0x3, zero: [4]uint8{0xe0, 0xab, 0xa6, 0x0}}, + 15: {id: 0xf, digitSize: 0x3, zero: [4]uint8{0xe0, 0xa9, 0xa6, 0x0}}, + 16: {id: 0x10, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xad, 0x90}}, + 17: {id: 0x11, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0x90, 0x0}}, + 18: {id: 0x12, digitSize: 0x3, zero: [4]uint8{0xea, 0xa4, 0x80, 0x0}}, + 19: {id: 0x13, digitSize: 0x3, zero: [4]uint8{0xe1, 0x9f, 0xa0, 0x0}}, + 20: {id: 0x14, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb3, 0xa6, 0x0}}, + 21: {id: 0x15, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x80, 0x0}}, + 22: {id: 0x16, digitSize: 0x3, zero: [4]uint8{0xe1, 0xaa, 0x90, 0x0}}, + 23: {id: 0x17, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbb, 0x90, 0x0}}, + 24: {id: 0x18, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x80, 0x0}}, + 25: {id: 0x19, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa5, 0x86, 0x0}}, + 26: {id: 0x1a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x8e}}, + 27: {id: 0x1b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0x98}}, + 28: {id: 0x1c, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xb6}}, + 29: {id: 0x1d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xac}}, + 30: {id: 0x1e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x9d, 0x9f, 0xa2}}, + 31: {id: 0x1f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb5, 0xa6, 0x0}}, + 32: {id: 0x20, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x99, 0x90}}, + 33: {id: 0x21, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa0, 0x90, 0x0}}, + 34: {id: 0x22, digitSize: 0x4, zero: [4]uint8{0xf0, 0x96, 0xa9, 0xa0}}, + 35: {id: 0x23, digitSize: 0x3, zero: [4]uint8{0xea, 0xaf, 0xb0, 0x0}}, + 36: {id: 0x24, digitSize: 0x3, zero: [4]uint8{0xe1, 0x81, 0x80, 0x0}}, + 37: {id: 0x25, digitSize: 0x3, zero: [4]uint8{0xe1, 0x82, 0x90, 0x0}}, + 38: {id: 0x26, digitSize: 0x3, zero: [4]uint8{0xea, 0xa7, 0xb0, 0x0}}, + 39: {id: 0x27, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x91, 0x90}}, + 40: {id: 0x28, digitSize: 0x2, zero: [4]uint8{0xdf, 0x80, 0x0, 0x0}}, + 41: {id: 0x29, digitSize: 0x3, zero: [4]uint8{0xe1, 0xb1, 0x90, 0x0}}, + 42: {id: 0x2a, digitSize: 0x3, zero: [4]uint8{0xe0, 0xad, 0xa6, 0x0}}, + 43: {id: 0x2b, digitSize: 0x4, zero: [4]uint8{0xf0, 0x90, 0x92, 0xa0}}, + 44: {id: 0x2c, digitSize: 0x3, zero: [4]uint8{0xea, 0xa3, 0x90, 0x0}}, + 45: {id: 0x2d, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x87, 0x90}}, + 46: {id: 0x2e, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x8b, 0xb0}}, + 47: {id: 0x2f, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb7, 0xa6, 0x0}}, + 48: {id: 0x30, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x83, 0xb0}}, + 49: {id: 0x31, digitSize: 0x3, zero: [4]uint8{0xe1, 0xae, 0xb0, 0x0}}, + 50: {id: 0x32, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x9b, 0x80}}, + 51: {id: 0x33, digitSize: 0x3, zero: [4]uint8{0xe1, 0xa7, 0x90, 0x0}}, + 52: {id: 0x34, digitSize: 0x3, zero: [4]uint8{0xe0, 0xaf, 0xa6, 0x0}}, + 53: {id: 0x35, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb1, 0xa6, 0x0}}, + 54: {id: 0x36, digitSize: 0x3, zero: [4]uint8{0xe0, 0xb9, 0x90, 0x0}}, + 55: {id: 0x37, digitSize: 0x3, zero: [4]uint8{0xe0, 0xbc, 0xa0, 0x0}}, + 56: {id: 0x38, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0x93, 0x90}}, + 57: {id: 0x39, digitSize: 0x3, zero: [4]uint8{0xea, 0x98, 0xa0, 0x0}}, + 58: {id: 0x3a, digitSize: 0x4, zero: [4]uint8{0xf0, 0x91, 0xa3, 0xa0}}, +} // Size: 378 bytes + +const ( + numAdlm = 0x1 + numAhom = 0x2 + numArab = 0x3 + numArabext = 0x4 + numArmn = 0x3b + numArmnlow = 0x3c + numBali = 0x5 + numBeng = 0x6 + numBhks = 0x7 + numBrah = 0x8 + numCakm = 0x9 + numCham = 0xa + numCyrl = 0x3d + numDeva = 0xb + numEthi = 0x3e + numFullwide = 0xc + numGeor = 0x3f + numGonm = 0xd + numGrek = 0x40 + numGreklow = 0x41 + numGujr = 0xe + numGuru = 0xf + numHanidays = 0x42 + numHanidec = 0x43 + numHans = 0x44 + numHansfin = 0x45 + numHant = 0x46 + numHantfin = 0x47 + numHebr = 0x48 + numHmng = 0x10 + numJava = 0x11 + numJpan = 0x49 + numJpanfin = 0x4a + numKali = 0x12 + numKhmr = 0x13 + numKnda = 0x14 + numLana = 0x15 + numLanatham = 0x16 + numLaoo = 0x17 + numLatn = 0x0 + numLepc = 0x18 + numLimb = 0x19 + numMathbold = 0x1a + numMathdbl = 0x1b + numMathmono = 0x1c + numMathsanb = 0x1d + numMathsans = 0x1e + numMlym = 0x1f + numModi = 0x20 + numMong = 0x21 + numMroo = 0x22 + numMtei = 0x23 + numMymr = 0x24 + numMymrshan = 0x25 + numMymrtlng = 0x26 + numNewa = 0x27 + numNkoo = 0x28 + numOlck = 0x29 + numOrya = 0x2a + numOsma = 0x2b + numRoman = 0x4b + numRomanlow = 0x4c + numSaur = 0x2c + numShrd = 0x2d + numSind = 0x2e + numSinh = 0x2f + numSora = 0x30 + numSund = 0x31 + numTakr = 0x32 + numTalu = 0x33 + numTaml = 0x4d + numTamldec = 0x34 + numTelu = 0x35 + numThai = 0x36 + numTibt = 0x37 + numTirh = 0x38 + numVaii = 0x39 + numWara = 0x3a + numNumberSystems +) + +var systemMap = map[string]system{ + "adlm": numAdlm, + "ahom": numAhom, + "arab": numArab, + "arabext": numArabext, + "armn": numArmn, + "armnlow": numArmnlow, + "bali": numBali, + "beng": numBeng, + "bhks": numBhks, + "brah": numBrah, + "cakm": numCakm, + "cham": numCham, + "cyrl": numCyrl, + "deva": numDeva, + "ethi": numEthi, + "fullwide": numFullwide, + "geor": numGeor, + "gonm": numGonm, + "grek": numGrek, + "greklow": numGreklow, + "gujr": numGujr, + "guru": numGuru, + "hanidays": numHanidays, + "hanidec": numHanidec, + "hans": numHans, + "hansfin": numHansfin, + "hant": numHant, + "hantfin": numHantfin, + "hebr": numHebr, + "hmng": numHmng, + "java": numJava, + "jpan": numJpan, + "jpanfin": numJpanfin, + "kali": numKali, + "khmr": numKhmr, + "knda": numKnda, + "lana": numLana, + "lanatham": numLanatham, + "laoo": numLaoo, + "latn": numLatn, + "lepc": numLepc, + "limb": numLimb, + "mathbold": numMathbold, + "mathdbl": numMathdbl, + "mathmono": numMathmono, + "mathsanb": numMathsanb, + "mathsans": numMathsans, + "mlym": numMlym, + "modi": numModi, + "mong": numMong, + "mroo": numMroo, + "mtei": numMtei, + "mymr": numMymr, + "mymrshan": numMymrshan, + "mymrtlng": numMymrtlng, + "newa": numNewa, + "nkoo": numNkoo, + "olck": numOlck, + "orya": numOrya, + "osma": numOsma, + "roman": numRoman, + "romanlow": numRomanlow, + "saur": numSaur, + "shrd": numShrd, + "sind": numSind, + "sinh": numSinh, + "sora": numSora, + "sund": numSund, + "takr": numTakr, + "talu": numTalu, + "taml": numTaml, + "tamldec": numTamldec, + "telu": numTelu, + "thai": numThai, + "tibt": numTibt, + "tirh": numTirh, + "vaii": numVaii, + "wara": numWara, +} + +var symIndex = [][12]uint8{ // 81 elements + 0: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 1: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 2: [12]uint8{0x0, 0x1, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 3: [12]uint8{0x1, 0x0, 0x2, 0xd, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 4: [12]uint8{0x0, 0x1, 0x2, 0x11, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0x10, 0xb}, + 5: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x12, 0xb}, + 6: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 7: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x13, 0xb}, + 8: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 9: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 10: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 11: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 12: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x14, 0x8, 0x9, 0xa, 0xb}, + 13: [12]uint8{0x0, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 14: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x16, 0xb}, + 15: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 16: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0x0}, + 17: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 18: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 19: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 20: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x19, 0x1a, 0xa, 0xb}, + 21: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 22: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0xa, 0xb}, + 23: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 24: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0x1d, 0xb}, + 25: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0x1e, 0x0}, + 26: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x1b, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 27: [12]uint8{0x0, 0x1, 0x2, 0x3, 0xe, 0xf, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 28: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x1f, 0xb}, + 29: [12]uint8{0x0, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 30: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x20, 0xb}, + 31: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x21, 0x7, 0x8, 0x9, 0x22, 0xb}, + 32: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x23, 0xb}, + 33: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x14, 0x8, 0x9, 0x24, 0xb}, + 34: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x18, 0x7, 0x8, 0x9, 0x24, 0xb}, + 35: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x25, 0xb}, + 36: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x26, 0xb}, + 37: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x27, 0xb}, + 38: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 39: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x29, 0xb}, + 40: [12]uint8{0x1, 0x0, 0x2, 0x3, 0xe, 0x1c, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 41: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2a, 0xb}, + 42: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2b, 0xb}, + 43: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x1b, 0x2c, 0x14, 0x8, 0x9, 0x24, 0xb}, + 44: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x0}, + 45: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 46: [12]uint8{0x1, 0x0, 0x2, 0x3, 0x4, 0x1b, 0x17, 0x7, 0x8, 0x9, 0xa, 0xb}, + 47: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2d, 0x0}, + 48: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2e, 0xb}, + 49: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x2f, 0xb}, + 50: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x30, 0x7, 0x8, 0x9, 0xa, 0xb}, + 51: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x31, 0xb}, + 52: [12]uint8{0x1, 0xc, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x32, 0xb}, + 53: [12]uint8{0x1, 0x15, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0xb}, + 54: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x33, 0xb}, + 55: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x34, 0xb}, + 56: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 57: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0x3d, 0xb}, + 58: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 59: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x3a, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 60: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x39, 0x40, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 61: [12]uint8{0x35, 0x36, 0x37, 0x41, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 62: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x3e, 0x3f, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0xb}, + 63: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x3b, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 64: [12]uint8{0x35, 0xc, 0x37, 0x38, 0x39, 0x42, 0x43, 0x7, 0x44, 0x9, 0x24, 0xb}, + 65: [12]uint8{0x35, 0x36, 0x37, 0x38, 0x39, 0x5, 0x3b, 0x7, 0x3c, 0x9, 0x33, 0xb}, + 66: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x46, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 67: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0x1d, 0xb}, + 68: [12]uint8{0x35, 0x36, 0x37, 0x11, 0xe, 0x1c, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 69: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x45, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 70: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x0}, + 71: [12]uint8{0x35, 0x1, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0xa, 0x35}, + 72: [12]uint8{0x1, 0xc, 0x37, 0x11, 0x45, 0x47, 0x43, 0x7, 0x3c, 0x9, 0x24, 0xb}, + 73: [12]uint8{0x35, 0x36, 0x2, 0x3, 0x45, 0x46, 0x43, 0x7, 0x8, 0x9, 0xa, 0x35}, + 74: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x31, 0x35}, + 75: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x4, 0x5, 0x43, 0x7, 0x3c, 0x9, 0x32, 0x35}, + 76: [12]uint8{0x35, 0x36, 0x37, 0x11, 0x48, 0x46, 0x43, 0x7, 0x3c, 0x9, 0x33, 0x35}, + 77: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0xa, 0x49}, + 78: [12]uint8{0x0, 0x1, 0x4a, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x28, 0xb}, + 79: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x9, 0x4b, 0xb}, + 80: [12]uint8{0x0, 0x1, 0x2, 0x3, 0x4, 0x5, 0x6, 0x7, 0x8, 0x4c, 0x4d, 0xb}, +} // Size: 996 bytes + +var symData = stringset.Set{ + Data: "" + // Size: 599 bytes + ".,;%+-E׉∞NaN:\u00a0\u200e%\u200e\u200e+\u200e-ليس\u00a0رقمًا٪NDТерхьаш" + + "\u00a0дац·’mnne×10^0/00INF−\u200e−ناعددepälukuՈչԹარ\u00a0არის\u00a0რიცხვ" + + "იZMdMсан\u00a0емес¤¤¤сан\u00a0эмесບໍ່\u200bແມ່ນ\u200bໂຕ\u200bເລກNSဂဏန်" + + "းမဟုတ်သောННне\u00a0числочыыһыла\u00a0буотах·10^epilohosan\u00a0dälTFЕs" + + "on\u00a0emasҳақиқий\u00a0сон\u00a0эмас非數值非数值٫٬؛٪\u061c\u061c+\u061c-اس؉ل" + + "يس\u00a0رقم\u200f+\u200f-\u200f−٪\u200f\u061c−×۱۰^؉\u200f\u200e+\u200e" + + "\u200e-\u200e\u200e−\u200e+\u200e:၊ཨང་མེན་གྲངས་མེདཨང་མད", + Index: []uint16{ // 79 elements + // Entry 0 - 3F + 0x0000, 0x0001, 0x0002, 0x0003, 0x0004, 0x0005, 0x0006, 0x0007, + 0x0009, 0x000c, 0x000f, 0x0012, 0x0013, 0x0015, 0x001c, 0x0020, + 0x0024, 0x0036, 0x0038, 0x003a, 0x0050, 0x0052, 0x0055, 0x0058, + 0x0059, 0x005e, 0x0062, 0x0065, 0x0068, 0x006e, 0x0078, 0x0080, + 0x0086, 0x00ae, 0x00af, 0x00b2, 0x00c2, 0x00c8, 0x00d8, 0x0105, + 0x0107, 0x012e, 0x0132, 0x0142, 0x015e, 0x0163, 0x016a, 0x0173, + 0x0175, 0x0177, 0x0180, 0x01a0, 0x01a9, 0x01b2, 0x01b4, 0x01b6, + 0x01b8, 0x01bc, 0x01bf, 0x01c2, 0x01c6, 0x01c8, 0x01d6, 0x01da, + // Entry 40 - 7F + 0x01de, 0x01e4, 0x01e9, 0x01ee, 0x01f5, 0x01fa, 0x0201, 0x0208, + 0x0211, 0x0215, 0x0218, 0x021b, 0x0230, 0x0248, 0x0257, + }, +} // Size: 797 bytes + +// langToDefaults maps a compact language index to the default numbering system +// and default symbol set +var langToDefaults = [775]symOffset{ + // Entry 0 - 3F + 0x8000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, 0x0000, + 0x0000, 0x0000, 0x8003, 0x0002, 0x0002, 0x0002, 0x0002, 0x0003, + 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, 0x0002, + 0x0003, 0x0003, 0x0003, 0x0003, 0x0002, 0x0002, 0x0002, 0x0004, + 0x0002, 0x0004, 0x0002, 0x0002, 0x0002, 0x0003, 0x0002, 0x0000, + 0x8005, 0x0000, 0x0000, 0x0000, 0x8006, 0x0005, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + // Entry 40 - 7F + 0x8009, 0x0000, 0x0000, 0x800a, 0x0000, 0x0000, 0x800c, 0x0001, + 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x800e, 0x0000, 0x0000, 0x0007, + 0x0007, 0x0000, 0x0000, 0x0000, 0x0000, 0x800f, 0x0008, 0x0008, + 0x8011, 0x0001, 0x0001, 0x0001, 0x803c, 0x0000, 0x0009, 0x0009, + 0x0009, 0x0000, 0x0000, 0x000a, 0x000b, 0x000a, 0x000c, 0x000a, + 0x000a, 0x000c, 0x000a, 0x000d, 0x000d, 0x000a, 0x000a, 0x0001, + 0x0001, 0x0000, 0x0001, 0x0001, 0x803f, 0x0000, 0x0000, 0x0000, + // Entry 80 - BF + 0x000e, 0x000e, 0x000e, 0x000f, 0x000f, 0x000f, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x000a, 0x0010, 0x0000, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0011, 0x0000, 0x000a, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000a, 0x0000, 0x0009, 0x0000, + 0x0000, 0x0012, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + // Entry C0 - FF + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0013, 0x0000, + 0x0000, 0x000f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, 0x0000, 0x0000, 0x0015, + 0x0015, 0x0006, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, + 0x0006, 0x0001, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, + // Entry 100 - 13F + 0x0000, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, + 0x0000, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0016, 0x0016, + 0x0017, 0x0017, 0x0001, 0x0001, 0x8041, 0x0018, 0x0018, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0019, 0x0019, 0x0000, 0x0000, + 0x0017, 0x0017, 0x0017, 0x8044, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0001, 0x0001, 0x0001, 0x0001, + // Entry 140 - 17F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x0001, 0x0001, 0x0006, 0x0006, 0x0006, 0x0006, 0x0000, 0x0000, + 0x8047, 0x0000, 0x0006, 0x0006, 0x001a, 0x001a, 0x001a, 0x001a, + 0x804a, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x804c, 0x001b, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x000a, 0x000a, 0x0001, 0x0001, + 0x001c, 0x001c, 0x0009, 0x0009, 0x804f, 0x0000, 0x0000, 0x0000, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x8052, 0x0006, 0x0006, 0x001d, 0x0006, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x001e, 0x001e, 0x001f, + 0x001f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0001, + 0x0001, 0x000d, 0x000d, 0x0000, 0x0000, 0x0020, 0x0020, 0x0006, + 0x0006, 0x0021, 0x0021, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x8054, 0x0000, 0x0000, 0x0000, 0x0000, 0x8056, 0x001b, + 0x0000, 0x0000, 0x0001, 0x0001, 0x0022, 0x0022, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x0000, 0x0023, 0x0023, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0024, 0x0024, 0x8058, 0x0000, 0x0000, 0x0016, 0x0016, 0x0006, + 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0025, 0x0025, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x000d, 0x000d, 0x0000, 0x0000, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x805a, 0x0000, 0x0000, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x805b, 0x0026, 0x805d, + // Entry 200 - 23F + 0x0000, 0x0000, 0x0000, 0x0000, 0x805e, 0x0015, 0x0015, 0x0000, + 0x0000, 0x0006, 0x0006, 0x0006, 0x8061, 0x0000, 0x0000, 0x8062, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0001, + 0x0001, 0x0015, 0x0015, 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0027, 0x0027, 0x0027, 0x8065, 0x8067, + 0x001b, 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, + 0x8069, 0x0028, 0x0006, 0x0001, 0x0006, 0x0001, 0x0001, 0x0001, + // Entry 240 - 27F + 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, 0x0000, + 0x0006, 0x0000, 0x0000, 0x001a, 0x001a, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0029, 0x0029, 0x0029, 0x0029, + 0x0029, 0x0029, 0x0029, 0x0006, 0x0006, 0x0000, 0x0000, 0x002a, + 0x002a, 0x0000, 0x0000, 0x0000, 0x0000, 0x806b, 0x0000, 0x0000, + 0x002b, 0x002b, 0x002b, 0x002b, 0x0006, 0x0006, 0x000d, 0x000d, + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0001, + 0x002c, 0x002c, 0x002d, 0x002d, 0x002e, 0x002e, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x002f, 0x002f, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0001, 0x0001, 0x0006, + 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, 0x0006, + 0x0006, 0x0006, 0x0000, 0x0000, 0x0000, 0x806d, 0x0022, 0x0022, + 0x0022, 0x0000, 0x0006, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0030, 0x0030, 0x0000, 0x0000, 0x8071, 0x0031, 0x0006, + // Entry 2C0 - 2FF + 0x0006, 0x0006, 0x0000, 0x0001, 0x0001, 0x000d, 0x000d, 0x0001, + 0x0001, 0x0000, 0x0000, 0x0032, 0x0032, 0x8074, 0x8076, 0x001b, + 0x8077, 0x8079, 0x0028, 0x807b, 0x0034, 0x0033, 0x0033, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x0006, 0x0006, 0x0000, + 0x0000, 0x0000, 0x0000, 0x0000, 0x0035, 0x0035, 0x0006, 0x0006, + 0x0000, 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0036, 0x0037, 0x0037, 0x0036, 0x0036, 0x0001, + 0x0001, 0x807d, 0x0000, 0x0000, 0x0000, 0x0000, 0x0000, 0x8080, + // Entry 300 - 33F + 0x0036, 0x0036, 0x0036, 0x0000, 0x0000, 0x0006, 0x0014, +} // Size: 1550 bytes + +// langToAlt is a list of numbering system and symbol set pairs, sorted and +// marked by compact language index. +var langToAlt = []altSymData{ // 131 elements + 1: {compactTag: 0x0, symIndex: 0x38, system: 0x3}, + 2: {compactTag: 0x0, symIndex: 0x42, system: 0x4}, + 3: {compactTag: 0xa, symIndex: 0x39, system: 0x3}, + 4: {compactTag: 0xa, symIndex: 0x2, system: 0x0}, + 5: {compactTag: 0x28, symIndex: 0x0, system: 0x6}, + 6: {compactTag: 0x2c, symIndex: 0x5, system: 0x0}, + 7: {compactTag: 0x2c, symIndex: 0x3a, system: 0x3}, + 8: {compactTag: 0x2c, symIndex: 0x42, system: 0x4}, + 9: {compactTag: 0x40, symIndex: 0x0, system: 0x6}, + 10: {compactTag: 0x43, symIndex: 0x0, system: 0x0}, + 11: {compactTag: 0x43, symIndex: 0x4f, system: 0x37}, + 12: {compactTag: 0x46, symIndex: 0x1, system: 0x0}, + 13: {compactTag: 0x46, symIndex: 0x38, system: 0x3}, + 14: {compactTag: 0x54, symIndex: 0x0, system: 0x9}, + 15: {compactTag: 0x5d, symIndex: 0x3a, system: 0x3}, + 16: {compactTag: 0x5d, symIndex: 0x8, system: 0x0}, + 17: {compactTag: 0x60, symIndex: 0x1, system: 0x0}, + 18: {compactTag: 0x60, symIndex: 0x38, system: 0x3}, + 19: {compactTag: 0x60, symIndex: 0x42, system: 0x4}, + 20: {compactTag: 0x60, symIndex: 0x0, system: 0x5}, + 21: {compactTag: 0x60, symIndex: 0x0, system: 0x6}, + 22: {compactTag: 0x60, symIndex: 0x0, system: 0x8}, + 23: {compactTag: 0x60, symIndex: 0x0, system: 0x9}, + 24: {compactTag: 0x60, symIndex: 0x0, system: 0xa}, + 25: {compactTag: 0x60, symIndex: 0x0, system: 0xb}, + 26: {compactTag: 0x60, symIndex: 0x0, system: 0xc}, + 27: {compactTag: 0x60, symIndex: 0x0, system: 0xd}, + 28: {compactTag: 0x60, symIndex: 0x0, system: 0xe}, + 29: {compactTag: 0x60, symIndex: 0x0, system: 0xf}, + 30: {compactTag: 0x60, symIndex: 0x0, system: 0x11}, + 31: {compactTag: 0x60, symIndex: 0x0, system: 0x12}, + 32: {compactTag: 0x60, symIndex: 0x0, system: 0x13}, + 33: {compactTag: 0x60, symIndex: 0x0, system: 0x14}, + 34: {compactTag: 0x60, symIndex: 0x0, system: 0x15}, + 35: {compactTag: 0x60, symIndex: 0x0, system: 0x16}, + 36: {compactTag: 0x60, symIndex: 0x0, system: 0x17}, + 37: {compactTag: 0x60, symIndex: 0x0, system: 0x18}, + 38: {compactTag: 0x60, symIndex: 0x0, system: 0x19}, + 39: {compactTag: 0x60, symIndex: 0x0, system: 0x1f}, + 40: {compactTag: 0x60, symIndex: 0x0, system: 0x21}, + 41: {compactTag: 0x60, symIndex: 0x0, system: 0x23}, + 42: {compactTag: 0x60, symIndex: 0x0, system: 0x24}, + 43: {compactTag: 0x60, symIndex: 0x0, system: 0x25}, + 44: {compactTag: 0x60, symIndex: 0x0, system: 0x28}, + 45: {compactTag: 0x60, symIndex: 0x0, system: 0x29}, + 46: {compactTag: 0x60, symIndex: 0x0, system: 0x2a}, + 47: {compactTag: 0x60, symIndex: 0x0, system: 0x2b}, + 48: {compactTag: 0x60, symIndex: 0x0, system: 0x2c}, + 49: {compactTag: 0x60, symIndex: 0x0, system: 0x2d}, + 50: {compactTag: 0x60, symIndex: 0x0, system: 0x30}, + 51: {compactTag: 0x60, symIndex: 0x0, system: 0x31}, + 52: {compactTag: 0x60, symIndex: 0x0, system: 0x32}, + 53: {compactTag: 0x60, symIndex: 0x0, system: 0x33}, + 54: {compactTag: 0x60, symIndex: 0x0, system: 0x34}, + 55: {compactTag: 0x60, symIndex: 0x0, system: 0x35}, + 56: {compactTag: 0x60, symIndex: 0x0, system: 0x36}, + 57: {compactTag: 0x60, symIndex: 0x0, system: 0x37}, + 58: {compactTag: 0x60, symIndex: 0x0, system: 0x39}, + 59: {compactTag: 0x60, symIndex: 0x0, system: 0x43}, + 60: {compactTag: 0x64, symIndex: 0x0, system: 0x0}, + 61: {compactTag: 0x64, symIndex: 0x38, system: 0x3}, + 62: {compactTag: 0x64, symIndex: 0x42, system: 0x4}, + 63: {compactTag: 0x7c, symIndex: 0x50, system: 0x37}, + 64: {compactTag: 0x7c, symIndex: 0x0, system: 0x0}, + 65: {compactTag: 0x114, symIndex: 0x43, system: 0x4}, + 66: {compactTag: 0x114, symIndex: 0x18, system: 0x0}, + 67: {compactTag: 0x114, symIndex: 0x3b, system: 0x3}, + 68: {compactTag: 0x123, symIndex: 0x1, system: 0x0}, + 69: {compactTag: 0x123, symIndex: 0x3c, system: 0x3}, + 70: {compactTag: 0x123, symIndex: 0x44, system: 0x4}, + 71: {compactTag: 0x158, symIndex: 0x0, system: 0x0}, + 72: {compactTag: 0x158, symIndex: 0x3b, system: 0x3}, + 73: {compactTag: 0x158, symIndex: 0x45, system: 0x4}, + 74: {compactTag: 0x160, symIndex: 0x0, system: 0x0}, + 75: {compactTag: 0x160, symIndex: 0x38, system: 0x3}, + 76: {compactTag: 0x16d, symIndex: 0x1b, system: 0x0}, + 77: {compactTag: 0x16d, symIndex: 0x0, system: 0x9}, + 78: {compactTag: 0x16d, symIndex: 0x0, system: 0xa}, + 79: {compactTag: 0x17c, symIndex: 0x0, system: 0x0}, + 80: {compactTag: 0x17c, symIndex: 0x3d, system: 0x3}, + 81: {compactTag: 0x17c, symIndex: 0x42, system: 0x4}, + 82: {compactTag: 0x182, symIndex: 0x6, system: 0x0}, + 83: {compactTag: 0x182, symIndex: 0x38, system: 0x3}, + 84: {compactTag: 0x1b1, symIndex: 0x0, system: 0x0}, + 85: {compactTag: 0x1b1, symIndex: 0x3e, system: 0x3}, + 86: {compactTag: 0x1b6, symIndex: 0x42, system: 0x4}, + 87: {compactTag: 0x1b6, symIndex: 0x1b, system: 0x0}, + 88: {compactTag: 0x1d2, symIndex: 0x42, system: 0x4}, + 89: {compactTag: 0x1d2, symIndex: 0x0, system: 0x0}, + 90: {compactTag: 0x1f3, symIndex: 0x0, system: 0xb}, + 91: {compactTag: 0x1fd, symIndex: 0x4e, system: 0x24}, + 92: {compactTag: 0x1fd, symIndex: 0x26, system: 0x0}, + 93: {compactTag: 0x1ff, symIndex: 0x42, system: 0x4}, + 94: {compactTag: 0x204, symIndex: 0x15, system: 0x0}, + 95: {compactTag: 0x204, symIndex: 0x3f, system: 0x3}, + 96: {compactTag: 0x204, symIndex: 0x46, system: 0x4}, + 97: {compactTag: 0x20c, symIndex: 0x0, system: 0xb}, + 98: {compactTag: 0x20f, symIndex: 0x6, system: 0x0}, + 99: {compactTag: 0x20f, symIndex: 0x38, system: 0x3}, + 100: {compactTag: 0x20f, symIndex: 0x42, system: 0x4}, + 101: {compactTag: 0x22e, symIndex: 0x0, system: 0x0}, + 102: {compactTag: 0x22e, symIndex: 0x47, system: 0x4}, + 103: {compactTag: 0x22f, symIndex: 0x42, system: 0x4}, + 104: {compactTag: 0x22f, symIndex: 0x1b, system: 0x0}, + 105: {compactTag: 0x238, symIndex: 0x42, system: 0x4}, + 106: {compactTag: 0x238, symIndex: 0x28, system: 0x0}, + 107: {compactTag: 0x265, symIndex: 0x38, system: 0x3}, + 108: {compactTag: 0x265, symIndex: 0x0, system: 0x0}, + 109: {compactTag: 0x29d, symIndex: 0x22, system: 0x0}, + 110: {compactTag: 0x29d, symIndex: 0x40, system: 0x3}, + 111: {compactTag: 0x29d, symIndex: 0x48, system: 0x4}, + 112: {compactTag: 0x29d, symIndex: 0x4d, system: 0xc}, + 113: {compactTag: 0x2bd, symIndex: 0x31, system: 0x0}, + 114: {compactTag: 0x2bd, symIndex: 0x3e, system: 0x3}, + 115: {compactTag: 0x2bd, symIndex: 0x42, system: 0x4}, + 116: {compactTag: 0x2cd, symIndex: 0x1b, system: 0x0}, + 117: {compactTag: 0x2cd, symIndex: 0x49, system: 0x4}, + 118: {compactTag: 0x2ce, symIndex: 0x49, system: 0x4}, + 119: {compactTag: 0x2d0, symIndex: 0x33, system: 0x0}, + 120: {compactTag: 0x2d0, symIndex: 0x4a, system: 0x4}, + 121: {compactTag: 0x2d1, symIndex: 0x42, system: 0x4}, + 122: {compactTag: 0x2d1, symIndex: 0x28, system: 0x0}, + 123: {compactTag: 0x2d3, symIndex: 0x34, system: 0x0}, + 124: {compactTag: 0x2d3, symIndex: 0x4b, system: 0x4}, + 125: {compactTag: 0x2f9, symIndex: 0x0, system: 0x0}, + 126: {compactTag: 0x2f9, symIndex: 0x38, system: 0x3}, + 127: {compactTag: 0x2f9, symIndex: 0x42, system: 0x4}, + 128: {compactTag: 0x2ff, symIndex: 0x36, system: 0x0}, + 129: {compactTag: 0x2ff, symIndex: 0x41, system: 0x3}, + 130: {compactTag: 0x2ff, symIndex: 0x4c, system: 0x4}, +} // Size: 810 bytes + +var tagToDecimal = []uint8{ // 775 elements + // Entry 0 - 3F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 40 - 7F + 0x05, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, + // Entry 80 - BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry C0 - FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 100 - 13F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 140 - 17F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 180 - 1BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 1C0 - 1FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, 0x05, + 0x01, 0x01, 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 200 - 23F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x05, 0x01, + 0x01, 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 240 - 27F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 280 - 2BF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x05, + 0x05, 0x05, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 2C0 - 2FF + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + // Entry 300 - 33F + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x08, +} // Size: 799 bytes + +var tagToScientific = []uint8{ // 775 elements + // Entry 0 - 3F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 40 - 7F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 80 - BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry C0 - FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 100 - 13F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 140 - 17F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, + 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 180 - 1BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 1C0 - 1FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 200 - 23F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x0c, 0x02, + 0x02, 0x0c, 0x0c, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 240 - 27F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x0d, 0x0d, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 280 - 2BF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 2C0 - 2FF + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + // Entry 300 - 33F + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x09, +} // Size: 799 bytes + +var tagToPercent = []uint8{ // 775 elements + // Entry 0 - 3F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x06, 0x06, 0x03, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, 0x03, + 0x03, 0x04, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x07, 0x07, 0x04, 0x04, + // Entry 80 - BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, 0x03, 0x04, + 0x04, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry C0 - FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 100 - 13F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + 0x0b, 0x0b, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x04, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + // Entry 140 - 17F + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 180 - 1BF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, 0x04, + // Entry 1C0 - 1FF + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 200 - 23F + 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x06, 0x04, + 0x04, 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 240 - 27F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x03, 0x03, 0x03, 0x03, 0x04, 0x04, + // Entry 280 - 2BF + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, 0x03, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x06, + 0x06, 0x06, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x0e, + // Entry 2C0 - 2FF + 0x0e, 0x0e, 0x04, 0x03, 0x03, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x03, + 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + // Entry 300 - 33F + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x0a, +} // Size: 799 bytes + +var formats = []Pattern{Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x0, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x3, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 3, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xc, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x9, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x03\u00a0%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xa, + GroupingSize: [2]uint8{0x3, + 0x2}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x8, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 6, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x6, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x3}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0xd, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x4}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x00\x01%", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x2, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x03%\u00a0\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x7, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x1, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x1}, + Affix: "\x01[\x01]", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x5, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x0, + MinIntegerDigits: 0x0, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x1, + GroupingSize: [2]uint8{0x0, + 0x0}, + Flags: 0x0}, + Pattern{RoundingContext: RoundingContext{MaxSignificantDigits: 0, + MaxFractionDigits: 0, + Increment: 0x0, + IncrementScale: 0x0, + Mode: 0x0, + DigitShift: 0x2, + MinIntegerDigits: 0x1, + MaxIntegerDigits: 0x0, + MinFractionDigits: 0x0, + MinSignificantDigits: 0x0, + MinExponentDigits: 0x0}, + Affix: "\x01%\x00", + Offset: 0x0, + NegOffset: 0x0, + PadRune: 0, + FormatWidth: 0x6, + GroupingSize: [2]uint8{0x3, + 0x0}, + Flags: 0x0}} + +// Total table size 8634 bytes (8KiB); checksum: 8F23386D diff --git a/vendor/golang.org/x/text/internal/stringset/set.go b/vendor/golang.org/x/text/internal/stringset/set.go new file mode 100644 index 0000000..bb2fffb --- /dev/null +++ b/vendor/golang.org/x/text/internal/stringset/set.go @@ -0,0 +1,86 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package stringset provides a way to represent a collection of strings +// compactly. +package stringset + +import "sort" + +// A Set holds a collection of strings that can be looked up by an index number. +type Set struct { + // These fields are exported to allow for code generation. + + Data string + Index []uint16 +} + +// Elem returns the string with index i. It panics if i is out of range. +func (s *Set) Elem(i int) string { + return s.Data[s.Index[i]:s.Index[i+1]] +} + +// Len returns the number of strings in the set. +func (s *Set) Len() int { + return len(s.Index) - 1 +} + +// Search returns the index of the given string or -1 if it is not in the set. +// The Set must have been created with strings in sorted order. +func Search(s *Set, str string) int { + // TODO: optimize this if it gets used a lot. + n := len(s.Index) - 1 + p := sort.Search(n, func(i int) bool { + return s.Elem(i) >= str + }) + if p == n || str != s.Elem(p) { + return -1 + } + return p +} + +// A Builder constructs Sets. +type Builder struct { + set Set + index map[string]int +} + +// NewBuilder returns a new and initialized Builder. +func NewBuilder() *Builder { + return &Builder{ + set: Set{ + Index: []uint16{0}, + }, + index: map[string]int{}, + } +} + +// Set creates the set created so far. +func (b *Builder) Set() Set { + return b.set +} + +// Index returns the index for the given string, which must have been added +// before. +func (b *Builder) Index(s string) int { + return b.index[s] +} + +// Add adds a string to the index. Strings that are added by a single Add will +// be stored together, unless they match an existing string. +func (b *Builder) Add(ss ...string) { + // First check if the string already exists. + for _, s := range ss { + if _, ok := b.index[s]; ok { + continue + } + b.index[s] = len(b.set.Index) - 1 + b.set.Data += s + x := len(b.set.Data) + if x > 0xFFFF { + panic("Index too > 0xFFFF") + } + b.set.Index = append(b.set.Index, uint16(x)) + } +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 0000000..b5d3488 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 0000000..a24fd1a --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 0000000..212b77c --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 0000000..4d9c661 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// nextToken returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 0000000..1153baf --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 0000000..053336e --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), nil +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 0000000..a6573dc --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 +) +const ( + _Latn = 91 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 +) + +var regionToGroups = []uint8{ // 359 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, + // Entry C0 - FF + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7c}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 0000000..42ea792 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index f3a234e..b3cf5d9 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -121,8 +121,12 @@ func (p Properties) BoundaryAfter() bool { // // When all 6 bits are zero, the character is inert, meaning it is never // influenced by normalization. +// +// We set flags to 0x80 (high bit 7 unused in quick check data) to indicate an invalid rune. type qcInfo uint8 +func (p Properties) isInvalid() bool { return p.flags == 0x80 } + func (p Properties) isYesC() bool { return p.flags&0x10 == 0 } func (p Properties) isYesD() bool { return p.flags&0x4 == 0 } @@ -247,6 +251,9 @@ func (f Form) PropertiesString(s string) Properties { // to a Properties. See the comment at the top of the file // for more information on the format. func compInfo(v uint16, sz int) Properties { + if sz == 0 { + return Properties{flags: 0x80, size: 1} + } if v == 0 { return Properties{size: uint8(sz)} } else if v >= 0x8000 { @@ -254,7 +261,7 @@ func compInfo(v uint16, sz int) Properties { size: uint8(sz), ccc: uint8(v), tccc: uint8(v), - flags: qcInfo(v >> 8), + flags: qcInfo(v>>8) & 0x3f, } if p.ccc > 0 || p.combinesBackward() { p.nLead = uint8(p.flags & 0x3) diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index 417c6b2..3cc0592 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -376,16 +376,12 @@ func nextComposed(i *Iter) []byte { goto doNorm } prevCC = i.info.tccc - sz := int(i.info.size) - if sz == 0 { - sz = 1 // illegal rune: copy byte-by-byte - } - p := outp + sz + p := outp + int(i.info.size) if p > len(i.buf) { break } outp = p - i.p += sz + i.p += int(i.info.size) if i.p >= i.rb.nsrc { i.setDone() break diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index 4747ad0..60b1511 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -148,7 +148,7 @@ func (f Form) IsNormalString(s string) bool { // patched buffer and whether the decomposition is still in progress. func patchTail(rb *reorderBuffer) bool { info, p := lastRuneStart(&rb.f, rb.out) - if p == -1 || info.size == 0 { + if p == -1 || info.isInvalid() { return true } end := p + int(info.size) @@ -225,7 +225,7 @@ func doAppend(rb *reorderBuffer, out []byte, p int) []byte { } fd := &rb.f if doMerge { - var info Properties + info := Properties{flags: 0x80, size: 1} // invalid rune if p < n { info = fd.info(src, p) if !info.BoundaryBefore() || info.nLeadingNonStarters() > 0 { @@ -235,7 +235,7 @@ func doAppend(rb *reorderBuffer, out []byte, p int) []byte { p = decomposeSegment(rb, p, true) } } - if info.size == 0 { + if info.isInvalid() { rb.doFlush() // Append incomplete UTF-8 encoding. return src.appendSlice(rb.out, p, n) @@ -314,7 +314,7 @@ func (f *formInfo) quickSpan(src input, i, end int, atEOF bool) (n int, ok bool) continue } info := f.info(src, i) - if info.size == 0 { + if info.isInvalid() { if atEOF { // include incomplete runes return n, true @@ -379,7 +379,7 @@ func (f Form) firstBoundary(src input, nsrc int) int { // CGJ insertion points correctly. Luckily it doesn't have to. for { info := fd.info(src, i) - if info.size == 0 { + if info.isInvalid() { return -1 } if s := ss.next(info); s != ssSuccess { @@ -424,7 +424,7 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { } fd := formTable[f] info := fd.info(src, 0) - if info.size == 0 { + if info.isInvalid() { if atEOF { return 1 } @@ -435,7 +435,7 @@ func (f Form) nextBoundary(src input, nsrc int, atEOF bool) int { for i := int(info.size); i < nsrc; i += int(info.size) { info = fd.info(src, i) - if info.size == 0 { + if info.isInvalid() { if atEOF { return i } @@ -465,7 +465,7 @@ func lastBoundary(fd *formInfo, b []byte) int { if p == -1 { return -1 } - if info.size == 0 { // ends with incomplete rune + if info.isInvalid() { // ends with incomplete rune if p == 0 { // starts with incomplete rune return -1 } @@ -504,7 +504,7 @@ func lastBoundary(fd *formInfo, b []byte) int { func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { // Force one character to be consumed. info := rb.f.info(rb.src, sp) - if info.size == 0 { + if info.isInvalid() { return 0 } if s := rb.ss.next(info); s == ssStarter { @@ -528,7 +528,7 @@ func decomposeSegment(rb *reorderBuffer, sp int, atEOF bool) int { break } info = rb.f.info(rb.src, sp) - if info.size == 0 { + if info.isInvalid() { if !atEOF { return int(iShortSrc) } diff --git a/vendor/modules.txt b/vendor/modules.txt index 5fcc0d3..0738aa6 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -53,10 +53,11 @@ github.com/go-openapi/runtime/server-middleware/negotiate/header # github.com/go-openapi/spec v0.22.6 ## explicit; go 1.25.0 github.com/go-openapi/spec -# github.com/go-openapi/strfmt v0.26.4 +# github.com/go-openapi/strfmt v0.27.0 ## explicit; go 1.25.0 github.com/go-openapi/strfmt github.com/go-openapi/strfmt/internal/bsonlite +github.com/go-openapi/strfmt/internal/countries # github.com/go-openapi/swag/conv v0.27.0 ## explicit; go 1.25.0 github.com/go-openapi/swag/conv @@ -144,14 +145,22 @@ go.opentelemetry.io/otel/trace/noop # go.yaml.in/yaml/v3 v3.0.4 ## explicit; go 1.16 go.yaml.in/yaml/v3 -# golang.org/x/net v0.56.0 +# golang.org/x/net v0.57.0 ## explicit; go 1.25.0 golang.org/x/net/idna # golang.org/x/sync v0.22.0 ## explicit; go 1.25.0 golang.org/x/sync/errgroup -# golang.org/x/text v0.38.0 -## explicit; go 1.25.0 +# golang.org/x/text v0.40.0 +## explicit; go 1.25.0 +golang.org/x/text/currency +golang.org/x/text/internal/format +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/number +golang.org/x/text/internal/stringset +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi