From 853116385d820dd9b838f4f57672ceb08e970814 Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 10:40:58 +0930 Subject: [PATCH 01/10] Add Rfam/Infernal ncRNA annotation via --rfam pharokka had no covariance-model search, so structured RNAs (riboswitches, ribozymes, regulatory sRNAs, introns) were invisible. `--rfam` scans the genome against Rfam 15.1 with Infernal cmscan. Opt-in, because it roughly doubles runtime on a small phage genome (~30-60s measured). Flags and defaults are driven by measurement, not guesswork: - `--rfam` filter preset is mandatory: Infernal derives filter strictness from database size, so on a phage-sized target the defaults go permissive and a 58 kb genome takes >25 min instead of 32 s. - `--fmt 2` + `--clanin` enables clan competition; parsing drops `olp == '='` rows, without which riboswitch clans emit piles of redundant overlapping calls for one locus. - Rfam tRNA/tmRNA hits are dropped by default. RF00023 does not hit the tmRNA in NC_051700 that ARAGORN finds, so Rfam is additive and must never displace the specialised tools. Locked in by a regression test. - `--cpu` is passed through but does not help a single contig: Infernal parallelises over the sequence database, so 8 cpus measured slower than 1 on one 42 kb genome. It does help in --meta mode. New outputs: `{prefix}_ncrna.tsv`, `{prefix}_cmscan.tblout`, `ncRNA` features in the GFF/GBK, and an `ncRNAs` count per contig in `_cds_functions.tsv`. Also fixed two latent database bugs found along the way: the tarball filename and the PHROGs version marker were both hardcoded to 1.8.0 rather than derived from the database version, so any version bump would have silently used stale names. The v1.11.0 database URL and md5 are placeholders pending the Zenodo upload. Co-Authored-By: Claude Opus 5 --- docs/changelog.md | 46 + docs/citation.md | 5 + docs/install.md | 2 + docs/output.md | 25 +- docs/run.md | 24 + scripts/build_rfam_db.sh | 53 + scripts/build_rfam_metadata.py | 135 + src/pharokka/databases.py | 72 +- src/pharokka/input_commands.py | 55 +- src/pharokka/post_processing.py | 105 +- src/pharokka/processes.py | 46 + src/pharokka/rfam.py | 283 + src/pharokka/run.py | 35 +- src/pharokka/version.py | 2 +- tests/test_data/rfam/Rfam.clanin | 1 + tests/test_data/rfam/Rfam.cm | 6732 ++++++++++++++++++++++++ tests/test_data/rfam/Rfam_metadata.tsv | 6 + tests/test_rfam.py | 369 ++ 18 files changed, 7968 insertions(+), 28 deletions(-) create mode 100755 scripts/build_rfam_db.sh create mode 100755 scripts/build_rfam_metadata.py create mode 100644 src/pharokka/rfam.py create mode 100644 tests/test_data/rfam/Rfam.clanin create mode 100644 tests/test_data/rfam/Rfam.cm create mode 100644 tests/test_data/rfam/Rfam_metadata.tsv create mode 100644 tests/test_rfam.py diff --git a/docs/changelog.md b/docs/changelog.md index b6668fe..06f630c 100644 --- a/docs/changelog.md +++ b/docs/changelog.md @@ -1,5 +1,51 @@ # Changelog +## v1.11.0 — ncRNA annotation with Infernal and Rfam + +### `--rfam` + +`pharokka run --rfam` annotates non-coding RNAs by scanning the genome against +[Rfam](https://rfam.org) 15.1 (4,227 covariance models) with +[Infernal](http://eddylab.org/infernal/) `cmscan`. This picks up structured +RNAs that pharokka previously could not see at all — riboswitches, ribozymes, +regulatory sRNAs, group I/II introns and leader elements. + +It is **opt-in**, because it roughly doubles the runtime for a small phage +genome (approximately 30–60 seconds, depending on genome size). + +```bash +pharokka run -i phage.fasta -o output -d database --rfam +``` + +New outputs: + +* `{prefix}_ncrna.tsv` — one row per ncRNA, with Rfam accession, family, type, + coordinates, bit score and E-value. +* `{prefix}_cmscan.tblout` — the raw Infernal output. +* `ncRNA` features in the `.gff` and `.gbk`, and an `ncRNAs` row per contig in + `{prefix}_cds_functions.tsv`. + +By default, Rfam tRNA (RF00005) and tmRNA (RF00023) hits are discarded, since +tRNAscan-SE and ARAGORN already annotate these and are more sensitive on phage +sequence. Pass `--rfam_keep_trna` to keep them. + +**Rfam does not replace tRNAscan-SE, ARAGORN or MinCED** — it is purely +additive. + +### Requirements + +* Infernal >= 1.1.4 must be installed (`conda install -c bioconda infernal`). + It is only checked when `--rfam` is used. +* Requires the v1.11.0 database, which adds the pressed Rfam covariance models. + Re-run `pharokka install` to update. + +### Other changes + +* Fixed the database tarball filename being hardcoded to `v1.8.0` rather than + derived from the database version. +* The PHROGs database version marker file is now derived from the database + version instead of being hardcoded. + ## v1.10.0 — CLI Redesign & Polars Refactor ### New subcommand-based CLI diff --git a/docs/citation.md b/docs/citation.md index 0f0b3b2..f6ece34 100644 --- a/docs/citation.md +++ b/docs/citation.md @@ -24,6 +24,11 @@ With the following full citations for the constituent tools below where relevant * Larralde M. and Camargo A., (2023) Pyrodigal-gv: A Pyrodigal extension to predict genes in giant viruses and viruses with alternative genetic code. https://github.com/althonos/pyrodigal-gv. * Shimoyama, Y. (2022). pyCirclize: Circular visualization in Python [Computer software]. https://github.com/moshi4/pyCirclize +If you use `--rfam` to annotate non-coding RNAs, please additionally cite: + +* Nawrocki E.P., Eddy S.R., "Infernal 1.1: 100-fold faster RNA homology searches", Bioinformatics (2013) https://doi.org/10.1093/bioinformatics/btt509. +* Ontiveros-Palacios N., Cooke E., Nawrocki E.P., Triebel S., Marz M., Rivas E., Griffiths-Jones S., Petrov A.I., Bateman A., Sweeney B., "Rfam 15: RNA families database in 2025", Nucleic Acids Research (2025) https://doi.org/10.1093/nar/gkae1023. + If you also use `phold` (recommended) to improve annotations after `pharokka`, please additionally cite: * Bouras G., Grigson S.R., Mirdita M., Heinzinger M., Papudeshi B., Mallawaarachchi V., Green R., Kim S.R., Mihalia V., Psaltis A.J., Wormald P-J., Vreugde S., Steinegger M., Edwards R.A. Protein Structure Informed Bacteriophage Genome Annotation with Phold. *Nucleic Acids Research*, Volume 54, Issue 1, 13 January 2026, gkaf1448, https://doi.org/10.1093/nar/gkaf1448 \ No newline at end of file diff --git a/docs/install.md b/docs/install.md index db7bdbd..9c41797 100644 --- a/docs/install.md +++ b/docs/install.md @@ -71,6 +71,8 @@ pharokka --help * **Note: v1.8.0 uses a new MMseqs2 PHROG profile database format that is incompatible with the v1.4.0 database. If upgrading from v1.7.x or earlier, you must re-run `pharokka install` to fetch the updated database.** +* **Note: v1.11.0 adds the Rfam 15.1 covariance models used by `--rfam`. These make the database download considerably larger. If you are upgrading from v1.10.x or earlier and want to use `--rfam`, re-run `pharokka install`. Everything else in pharokka works fine with an older database.** + To install the pharokka database to the default directory: ```bash diff --git a/docs/output.md b/docs/output.md index cf7cf00..422b387 100644 --- a/docs/output.md +++ b/docs/output.md @@ -18,7 +18,30 @@ The main output is a `.gff` GFF3 file suitable for use in downstream pangenomic * A `.tbl` file, which is a flat-file table suitable for upload to NCBI's BankIt. -* A `_cds_functions.tsv` file, which includes counts of CDSs, tRNAs, CRISPRs and tmRNAs, and functions assigned to CDSs according to the PHROGs database. +* A `_cds_functions.tsv` file, which includes counts of CDSs, tRNAs, CRISPRs and tmRNAs, and functions assigned to CDSs according to the PHROGs database. If `--rfam` is used, an `ncRNAs` count is also included. + +* If `--rfam` is used, a `_ncrna.tsv` file with one row per non-coding RNA detected by Infernal against Rfam. The columns are: + + | Column | Description | + |--------|-------------| + | `contig` | Contig name | + | `locus_tag` | pharokka locus tag, e.g. `PHAGE_ncRNA_1` | + | `start`, `stop` | 1-based inclusive coordinates (always `start` < `stop`) | + | `strand` | `+` or `-` | + | `rfam_acc` | Rfam accession, e.g. `RF00050` | + | `rfam_id` | Rfam family name, e.g. `FMN` | + | `type` | Rfam family type, e.g. `Cis-reg; riboswitch;` | + | `description` | Rfam family description | + | `clan` | Rfam clan accession, if the family belongs to one | + | `bitscore` | Infernal bit score | + | `evalue` | Infernal E-value | + | `gc` | GC fraction of the hit | + | `trunc` | Whether the hit is truncated at a sequence end | + | `mdl_from`, `mdl_to` | Coordinates within the covariance model, which show whether the match is partial | + + ncRNAs also appear as `ncRNA` features in the `.gff` and `.gbk` files. + +* If `--rfam` is used, a `_cmscan.tblout` file holding the raw Infernal `cmscan` output. * A `_length_gc_cds_density.tsv` file, which outputs the phage's length, GC percentage, translation table and CDS coding density. diff --git a/docs/run.md b/docs/run.md index 354a511..f55d209 100644 --- a/docs/run.md +++ b/docs/run.md @@ -145,6 +145,30 @@ As of v1.5.0, you can skip running tRNAscan-SE 2, MinCED and Aragorn using `--sk pharokka run -i -o -d -t --skip_extra_annotations ``` +## ncRNA annotation with Rfam + +As of v1.11.0, you can annotate non-coding RNAs (riboswitches, ribozymes, regulatory sRNAs, introns, leader elements) by scanning against [Rfam](https://rfam.org) with [Infernal](http://eddylab.org/infernal/) using `--rfam`: + +```bash +pharokka run -i -o -d -t --rfam +``` + +This requires Infernal >= 1.1.4 to be installed, and the v1.11.0 database or newer. + +`--rfam` is **opt-in** because it is not free: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime. + +Two things worth knowing: + +* **`--threads` will not speed this up for a single contig.** Infernal parallelises over the sequence database rather than over covariance models, so with one contig there is nothing to divide up. Threads do help in `--meta` mode, where there are many contigs. + +* **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED.** It is purely additive. Rfam's tRNA (RF00005) and tmRNA (RF00023) models are less sensitive on phage sequence than the specialised tools, so hits to them are discarded by default to avoid duplicate and conflicting annotations. If you want them anyway: + +```bash +pharokka run -i -o -d -t --rfam --rfam_keep_trna +``` + +Results are written to `{prefix}_ncrna.tsv`, and as `ncRNA` features in the `.gff` and `.gbk`. See [Output](output.md) for the column descriptions. + There is also support for alternative genetic codes if `pharokka` is run with prodigal as a gene predictor using the `-c` flag. See Prodigal's [documentation](https://github.com/hyattpd/prodigal/wiki/Advice-by-Input-Type#alternate-genetic-codes), along with [Yutin et al. 2021](https://doi.org/10.1038/s41467-022-32979-6) and [Peters et al. 2022](https://doi.org/10.1038/s41467-022-32979-6) for more information: ```bash diff --git a/scripts/build_rfam_db.sh b/scripts/build_rfam_db.sh new file mode 100755 index 0000000..6570ab7 --- /dev/null +++ b/scripts/build_rfam_db.sh @@ -0,0 +1,53 @@ +#!/bin/bash +# Builds the Rfam component of the pharokka database. +# +# The Rfam release is PINNED - pharokka ships a fixed Rfam version inside the +# database tarball so that annotations are reproducible across runs and +# machines. To move to a new Rfam release you must also bump RFAM_VERSION and +# the database VERSION in src/pharokka/databases.py, and upload a new tarball. +# +# Requires: Infernal (cmpress) on $PATH. +# +# Output files, which belong at the top level of the pharokka database dir: +# Rfam.cm Rfam.cm.i1f Rfam.cm.i1i Rfam.cm.i1m Rfam.cm.i1p +# Rfam.clanin +# Rfam_metadata.tsv + +set -euo pipefail + +RFAM_VERSION="15.1" +RFAM_FTP="https://ftp.ebi.ac.uk/pub/databases/Rfam/${RFAM_VERSION}" +OUTDIR="${1:-rfam_db}" + +SCRIPT_DIR="$(cd "$(dirname "${BASH_SOURCE[0]}")" && pwd)" + +mkdir -p "$OUTDIR" +cd "$OUTDIR" + +echo "==> Downloading Rfam ${RFAM_VERSION}" +curl -sSL -O "${RFAM_FTP}/Rfam.cm.gz" +curl -sSL -O "${RFAM_FTP}/Rfam.clanin" +curl -sSL -O "${RFAM_FTP}/database_files/family.txt.gz" +curl -sSL -O "${RFAM_FTP}/database_files/clan_membership.txt.gz" + +echo "==> Decompressing covariance models" +gunzip -f Rfam.cm.gz + +echo "==> Pressing covariance models (this takes a few minutes)" +cmpress -F Rfam.cm + +echo "==> Building metadata table" +python "${SCRIPT_DIR}/build_rfam_metadata.py" \ + --family family.txt.gz \ + --clan-membership clan_membership.txt.gz \ + --cm Rfam.cm \ + --out Rfam_metadata.tsv + +echo "==> Cleaning up intermediates" +rm -f family.txt.gz clan_membership.txt.gz + +echo "==> Done. Files in ${OUTDIR}:" +ls -la Rfam.cm Rfam.cm.i1? Rfam.clanin Rfam_metadata.tsv +echo +echo "Copy these into the pharokka database directory before creating the" +echo "database tarball, then update db_url and md5 in src/pharokka/databases.py." diff --git a/scripts/build_rfam_metadata.py b/scripts/build_rfam_metadata.py new file mode 100755 index 0000000..0609ec8 --- /dev/null +++ b/scripts/build_rfam_metadata.py @@ -0,0 +1,135 @@ +#!/usr/bin/env python3 +"""Builds Rfam_metadata.tsv for the pharokka database directory. + +pharokka needs a small, fast lookup from Rfam accession to family name, type +and description so that cmscan hits can be annotated without parsing the +329 MB Rfam.cm flatfile at runtime. + +Inputs (all from the Rfam FTP for the pinned release): + family.txt.gz - family table (accession, id, description, type) + clan_membership.txt.gz - clan accession -> family accession + Rfam.cm - used only to cross-check that every model in the + database has a metadata row + +Usage: + python build_rfam_metadata.py \ + --family family.txt.gz \ + --clan-membership clan_membership.txt.gz \ + --cm Rfam.cm \ + --out Rfam_metadata.tsv +""" + +import argparse +import gzip +import re +import sys + +# 1-indexed columns of the Rfam family.txt MySQL dump that we care about +_F_ACC = 0 +_F_ID = 1 +_F_DESCRIPTION = 3 +_F_GA = 6 +_F_TYPE = 18 +_F_MIN_FIELDS = 19 + +_ACC_RE = re.compile(r"^RF\d{5}\t") + + +def _open(path): + return ( + gzip.open(path, "rt", errors="replace") if path.endswith(".gz") else open(path) + ) + + +def parse_family(path): + """Parses family.txt. + + Some fields (comment, description) contain embedded newlines, so a family + record is only started by a line beginning with an RF accession followed by + a tab. Continuation lines are ignored - every field we want precedes the + free-text comment. + """ + families = {} + with _open(path) as fh: + for line in fh: + if not _ACC_RE.match(line): + continue + fields = line.rstrip("\n").split("\t") + if len(fields) < _F_MIN_FIELDS: + continue + families[fields[_F_ACC]] = { + "rfam_id": fields[_F_ID], + "description": fields[_F_DESCRIPTION], + "ga_threshold": fields[_F_GA], + "type": fields[_F_TYPE], + } + return families + + +def parse_clan_membership(path): + """Parses clan_membership.txt -> {rfam_acc: clan_acc}.""" + clans = {} + with _open(path) as fh: + for line in fh: + fields = line.rstrip("\n").split("\t") + if len(fields) >= 2 and fields[0].startswith("CL"): + clans[fields[1]] = fields[0] + return clans + + +def accessions_in_cm(path): + """Every ACC present in the CM flatfile, to verify metadata completeness.""" + accessions = set() + with _open(path) as fh: + for line in fh: + if line.startswith("ACC "): + accessions.add(line.split(None, 1)[1].strip()) + return accessions + + +def main(): + parser = argparse.ArgumentParser(description=__doc__) + parser.add_argument("--family", required=True) + parser.add_argument("--clan-membership", required=True) + parser.add_argument("--cm", required=True) + parser.add_argument("--out", required=True) + args = parser.parse_args() + + families = parse_family(args.family) + clans = parse_clan_membership(args.clan_membership) + cm_accessions = accessions_in_cm(args.cm) + + print(f"parsed {len(families)} families, {len(clans)} clan memberships") + print(f"{len(cm_accessions)} models in {args.cm}") + + missing = cm_accessions - set(families) + if missing: + # not fatal - pharokka falls back to the cmscan description - but it + # means family.txt and Rfam.cm are from different releases + print( + f"WARNING: {len(missing)} model(s) have no family.txt row, " + f"e.g. {sorted(missing)[:5]}", + file=sys.stderr, + ) + + with open(args.out, "w") as out: + out.write("rfam_acc\trfam_id\ttype\tdescription\tga_threshold\tclan_acc\n") + for acc in sorted(cm_accessions): + info = families.get(acc, {}) + row = [ + acc, + info.get("rfam_id", ""), + info.get("type", ""), + info.get("description", ""), + info.get("ga_threshold", ""), + clans.get(acc, ""), + ] + # guard against stray tabs/newlines in the free-text fields + out.write("\t".join(f.replace("\t", " ").replace("\n", " ") for f in row)) + out.write("\n") + + print(f"wrote {len(cm_accessions)} rows to {args.out}") + + +if __name__ == "__main__": + main() diff --git a/src/pharokka/databases.py b/src/pharokka/databases.py index 34916b0..3e10072 100644 --- a/src/pharokka/databases.py +++ b/src/pharokka/databases.py @@ -42,7 +42,11 @@ from .util import remove_directory -VERSION = "1.8.0" +VERSION = "1.11.0" + +# Rfam release pinned into the pharokka database tarball. Bump this (and the +# database VERSION above) only when a new Rfam is packaged and uploaded. +RFAM_VERSION = "15.1" # to hold information about the different DBs VERSION_DICTIONARY = { @@ -76,11 +80,26 @@ "inphared_mash": "9Aug2025_genomes.fa.msh", "inphared_annot": "9Aug2025_data.tsv", }, + # v1.11.0 adds the Rfam 15.1 covariance models (cmpress'd) for --rfam + # ncRNA annotation. See scripts/build_rfam_db.sh for how they are built. + # TODO(gbouras13): fill in db_url + md5 once the tarball is uploaded to Zenodo. + "1.11.0": { + "md5": "TODO_MD5_AFTER_UPLOAD", + "major": 1, + "minor": 11, + "minorest": 0, + "db_url": "https://zenodo.org/record/TODO/files/pharokka_v1.11.0_databases.tar.gz", + "dir_name": "pharokka_v1.11.0_databases", + "inphared_mash": "9Aug2025_genomes.fa.msh", + "inphared_annot": "9Aug2025_data.tsv", + }, } PHROG_DB_NAMES = [ - "VERSION_1_8_0", + # version marker file shipped inside the database tarball; derived so it + # tracks VERSION rather than silently checking for a stale marker + f"VERSION_{VERSION.replace('.', '_')}", "phrogs_profile_db", "phrogs_profile_db.dbtype", "phrogs_profile_db.index", @@ -117,6 +136,19 @@ "CARD_h.index", ] +# Rfam covariance models, cmpress'd. Only required when --rfam is used, so +# these are checked separately (check_rfam_installation) rather than in +# check_db_installation, which gates the whole-database download. +RFAM_DB_NAMES = [ + "Rfam.cm", + "Rfam.cm.i1f", + "Rfam.cm.i1i", + "Rfam.cm.i1m", + "Rfam.cm.i1p", + "Rfam.clanin", + "Rfam_metadata.tsv", +] + def instantiate_install(db_dir): instantiate_dir(db_dir) @@ -133,7 +165,10 @@ def instantiate_install(db_dir): logger.info(f"Downloading Pharokka Databases from {db_url}.") - tarball_path = Path(f"{db_dir}/pharokka_v1.8.0_databases.tar.gz") + # derived from VERSION, not hardcoded - otherwise every database + # version bump silently keeps writing the old tarball name + tarball = f"{VERSION_DICTIONARY[VERSION]['dir_name']}.tar.gz" + tarball_path = Path(f"{db_dir}/{tarball}") download(db_url, tarball_path) @@ -260,3 +295,34 @@ def check_db_installation(db_dir): downloaded_flag = False return downloaded_flag + + +def check_rfam_installation(db_dir): + """Checks that the cmpress'd Rfam database is present. + + Only called when --rfam is specified. Rfam ships inside the pharokka + database tarball from v1.11.0 onwards, so a user with an older database + directory will have everything else but not these files - hence the + explicit, actionable error rather than a bare missing-file traceback. + + :param db_dir: pharokka database directory + :return: True if every Rfam file is present + """ + missing = [ + file_name + for file_name in RFAM_DB_NAMES + if not os.path.isfile(os.path.join(db_dir, file_name)) + ] + + if missing: + logger.error( + f"--rfam was specified but the Rfam database is missing from {db_dir}." + ) + logger.error(f"Missing file(s): {', '.join(missing)}") + logger.error( + "Rfam was added to the pharokka database in v1.11.0. Please re-run " + "'pharokka install' to download the updated database." + ) + return False + + return True diff --git a/src/pharokka/input_commands.py b/src/pharokka/input_commands.py index 2a9ef99..9f5c085 100644 --- a/src/pharokka/input_commands.py +++ b/src/pharokka/input_commands.py @@ -154,6 +154,16 @@ def get_input(): help="Skips running mash to find the closest match for each contig in INPHARED.", action="store_true", ) + parser.add_argument( + "--rfam", + help="Runs Infernal cmscan against Rfam to annotate ncRNAs (riboswitches, ribozymes, sRNAs etc). Adds approximately 30-60 seconds per phage genome.", + action="store_true", + ) + parser.add_argument( + "--rfam_keep_trna", + help="Keeps Rfam tRNA (RF00005) and tmRNA (RF00023) hits. By default these are discarded, as tRNAscan-SE and ARAGORN already annotate these features.", + action="store_true", + ) parser.add_argument( "--minced_args", help='extra commands to pass to MINced (please omit the leading hyphen for the first argument). You will need to use quotation marks e.g. --minced_args "minNR 2 -minRL 21"', @@ -408,9 +418,10 @@ def validate_threads(threads): logger.error(message) -def check_dependencies(skip_mash): +def check_dependencies(skip_mash, rfam=False): """Checks the dependencies and versions skip_mash flag from args, won't check mash is skip mash specified + rfam flag from args, only checks Infernal if --rfam is specified :return: """ ############# @@ -635,6 +646,47 @@ def check_dependencies(skip_mash): logger.info("mash version is ok.") + ############# + # infernal (cmscan) - only needed for --rfam + ############# + infernal_version = None + if rfam is True: + try: + process = sp.Popen(["cmscan", "-h"], stdout=sp.PIPE, stderr=sp.STDOUT) + except Exception: + logger.error( + "Infernal (cmscan) not found. It is required for --rfam. " + "Please install Infernal >=1.1.4 (e.g. conda install -c bioconda infernal)." + ) + + cmscan_out, _ = process.communicate() + cmscan_out = cmscan_out.decode() + + # e.g. '# INFERNAL 1.1.5 (Sep 2023)' + version_line = [ + line for line in cmscan_out.split("\n") if line.startswith("# INFERNAL") + ] + if not version_line: + logger.error("Could not determine the Infernal version from 'cmscan -h'.") + + infernal_version = version_line[0].split()[2] + infernal_major_version = int(infernal_version.split(".")[0]) + infernal_minor_version = int(infernal_version.split(".")[1]) + infernal_minorest_version = int(infernal_version.split(".")[2]) + + logger.info( + f"Infernal version found is v{infernal_major_version}.{infernal_minor_version}.{infernal_minorest_version}" + ) + + if infernal_major_version != 1: + logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + if infernal_minor_version != 1: + logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + if infernal_minorest_version < 4: + logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + + logger.info("Infernal version is ok.") + ############# # dnaapler ############# @@ -706,6 +758,7 @@ def check_dependencies(skip_mash): trna_version, aragorn_version, minced_version, + infernal_version, ) diff --git a/src/pharokka/post_processing.py b/src/pharokka/post_processing.py index 1018184..fc534dd 100644 --- a/src/pharokka/post_processing.py +++ b/src/pharokka/post_processing.py @@ -11,6 +11,7 @@ from loguru import logger from .processes import convert_gff_to_gbk +from .rfam import add_locus_tags, rfam_type_to_ncrna_class from .util import ( remove_directory, remove_file, @@ -56,8 +57,11 @@ def __init__( trna_version: str = None, aragorn_version: str = None, minced_version: str = None, + infernal_version: str = None, skip_extra_annotations: bool = False, reverse_mmseqs2: bool = False, + rfam_flag: bool = False, + ncrna_df=None, ) -> None: """ Parameters @@ -162,8 +166,11 @@ def __init__( self.trna_version = trna_version self.aragorn_version = aragorn_version self.minced_version = minced_version + self.infernal_version = infernal_version self.skip_extra_annotations = skip_extra_annotations self.reverse_mmseqs2 = reverse_mmseqs2 + self.rfam_flag = rfam_flag + self.ncrna_df = ncrna_df if ncrna_df is not None else pl.DataFrame() # Lazy cache of input FASTA records keyed by contig id. Built on first # access via _get_input_records(); avoids repeatedly re-parsing the # FASTA from disk in the downstream writers. @@ -689,6 +696,60 @@ def parse_aragorn(self): ) self.tmrna_flag = tmrna_flag + def _build_ncrna_gff_df(self): + """Converts the parsed Rfam ncRNA dataframe into GFF rows. + + Locus tags are assigned here rather than at parse time because the + random locustag prefix is only resolved in create_gff(). The tagged + frame is written back to self.ncrna_df so that {prefix}_ncrna.tsv and + the GFF agree. + """ + self.ncrna_df = add_locus_tags( + self.ncrna_df, self.locustag, self.length_df.height + ) + ncrna_df = self.ncrna_df + + attributes = pl.format( + "ID={};locus_tag={};product={};Dbxref=RFAM:{};ncRNA_class={};note={}", + pl.col("locus_tag"), + pl.col("locus_tag"), + pl.col("description"), + pl.col("rfam_acc"), + pl.col("type").map_elements(rfam_type_to_ncrna_class, return_dtype=pl.Utf8), + pl.col("rfam_id"), + ) + + return ( + ncrna_df.with_columns( + [ + pl.lit(f"profile:Infernal:{self.infernal_version}").alias("Method"), + pl.lit("ncRNA").alias("Region"), + pl.col("bitscore").cast(pl.Utf8).alias("score"), + pl.lit(".").alias("frame"), + attributes.alias("attributes"), + ] + ) + .select( + [ + "contig", + "Method", + "Region", + "start", + "stop", + "score", + "strand", + "frame", + "attributes", + ] + ) + .with_columns( + [ + pl.col("start").cast(pl.Int64), + pl.col("stop").cast(pl.Int64), + ] + ) + ) + def create_gff(self): """ Creates the pharokka.gff file @@ -1425,26 +1486,23 @@ def _safe_codon(s): + "\n" ) - # combine dfs depending on whether the elements were detected - if self.skip_extra_annotations is True: - df_list = [gff_df] - else: - if trna_empty is True and self.tmrna_flag is False and crispr_count == 0: - df_list = [gff_df] - elif trna_empty is False and self.tmrna_flag is False and crispr_count == 0: - df_list = [gff_df, trna_df] - elif trna_empty is True and self.tmrna_flag is True and crispr_count == 0: - df_list = [gff_df, tmrna_df] - elif trna_empty is True and self.tmrna_flag is False and crispr_count > 0: - df_list = [gff_df, minced_df] - elif trna_empty is False and self.tmrna_flag is True and crispr_count == 0: - df_list = [gff_df, trna_df, tmrna_df] - elif trna_empty is False and self.tmrna_flag is False and crispr_count > 0: - df_list = [gff_df, trna_df, minced_df] - elif trna_empty is True and self.tmrna_flag is True and crispr_count > 0: - df_list = [gff_df, tmrna_df, minced_df] - else: # all detected - df_list = [gff_df, trna_df, tmrna_df, minced_df] + # combine dfs depending on whether the elements were detected. + # Built additively rather than by enumerating every combination - the + # feature order (CDS, tRNA, tmRNA, CRISPR, ncRNA) is preserved, and + # adding a feature type no longer doubles the number of branches. + df_list = [gff_df] + if self.skip_extra_annotations is False: + if trna_empty is False: + df_list.append(trna_df) + if self.tmrna_flag is True: + df_list.append(tmrna_df) + if crispr_count > 0: + df_list.append(minced_df) + + # ncRNAs from Infernal/Rfam. Independent of --skip_extra_annotations, + # which only governs tRNAscan-SE, MinCED and ARAGORN. + if self.rfam_flag is True and self.ncrna_df.height > 0: + df_list.append(self._build_ncrna_gff_df()) total_gff = pl.concat(df_list, how="diagonal") @@ -1901,6 +1959,8 @@ def _counts_by_contig(src_df): crispr_counts = _counts_by_contig(crispr_df) tmrna_counts = _counts_by_contig(tmrna_df) + ncrna_counts = _counts_by_contig(self.ncrna_df) if self.rfam_flag else {} + # ─── VFDB / CARD counts. v1.9.1 used str.contains(contig) on the hit # row's contig column — preserved here in case the test suite ever # depends on substring matching (would need explicit handling if two @@ -1954,6 +2014,11 @@ def _counts_by_contig_contains(src_df, contig_names): counts.append(tmrna_counts.get(contig, 0)) contigs_out.append(contig) + if self.rfam_flag is True: + descriptions.append("ncRNAs") + counts.append(ncrna_counts.get(contig, 0)) + contigs_out.append(contig) + descriptions.append("VFDB_Virulence_Factors") counts.append(vfdb_counts.get(contig, 0)) contigs_out.append(contig) diff --git a/src/pharokka/processes.py b/src/pharokka/processes.py index fc961d1..eb82299 100644 --- a/src/pharokka/processes.py +++ b/src/pharokka/processes.py @@ -879,6 +879,52 @@ def run_aragorn(filepath_in, out_dir, prefix, logdir): logger.error("Error with Aragorn\n") +def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): + """Runs Infernal cmscan against Rfam to detect ncRNAs. + + Flag rationale, all measured against Rfam 15.1 with Infernal 1.1.5: + + --rfam mandatory. Infernal derives its filter strictness from the + database size, so on a phage-sized target the default filters + go permissive and the search takes >25 minutes instead of ~30 + seconds. + --cut_ga use Rfam's curated per-family gathering thresholds, which is + the only sane way to threshold 4000+ heterogeneous models. + --nohmmonly force full CM scoring rather than falling back to the HMM + filter - the secondary structure model is the entire point. + --fmt 2 adds the 'olp' column, which (together with --clanin) is what + makes clan competition usable when parsing. + --noali we only ever parse the tabular output. + + Note on --cpu: Infernal parallelises over the *sequence database*, not over + models, so this gives no speedup on a single contig (measured: 8 cpus was + slower than 1 on a 42 kb genome). It does help in --meta mode where there + are many contigs, which is why it is still passed through. + """ + logger.info("Running Infernal cmscan against Rfam.") + + rfam_cm = os.path.join(db_dir, "Rfam.cm") + clanin = os.path.join(db_dir, "Rfam.clanin") + tblout = os.path.join(out_dir, prefix + "_cmscan.tblout") + + cmscan = ExternalTool( + tool="cmscan", + input=f"{rfam_cm} {filepath_in}", + output=f"--tblout {tblout}", + params=( + f"--rfam --cut_ga --nohmmonly --noali --fmt 2 " + f"--clanin {clanin} --cpu {threads}" + ), + logdir=logdir, + outfile="", + ) + + try: + ExternalTool.run_tool(cmscan) + except Exception: + logger.error("Error with Infernal cmscan\n") + + def reorient_terminase(filepath_in, out_dir, prefix, terminase_strand, terminase_start): """Re-orients phage to begin with large terminase subunit.""" logger.info( diff --git a/src/pharokka/rfam.py b/src/pharokka/rfam.py new file mode 100644 index 0000000..341abc2 --- /dev/null +++ b/src/pharokka/rfam.py @@ -0,0 +1,283 @@ +"""Parsing of Infernal cmscan output against Rfam. + +The tabular output produced by ``cmscan --fmt 2`` is whitespace-delimited with +a fixed column order and a free-text description in the final field. The +columns are (1-indexed, as documented in the Infernal user guide): + + 1 idx 11 seq to 21 anyidx + 2 target name 12 strand 22 afrct1 + 3 accession 13 trunc 23 afrct2 + 4 query name 14 pass 24 winidx + 5 accession 15 gc 25 wfrct1 + 6 clan name 16 bias 26 wfrct2 + 7 mdl 17 score 27 mdl len + 8 mdl from 18 E-value 28 seq len + 9 mdl to 19 inc 29 description of target + 10 seq from 20 olp + +For *cmscan* the CM is the target and the input sequence is the query, so +``target name``/``accession`` are the Rfam family ID and accession, and +``query name`` is the contig. (This is the opposite of ``cmsearch``.) + +Note that ``mdl len`` and ``seq len`` (27/28) are present in Infernal 1.1.5 but +not in the column layout given in some older documentation, so the description +starts at field 29. Verified against real cmscan 1.1.5 output. +""" + +import os + +import polars as pl +from loguru import logger + +# Column indices into a --fmt 2 cmscan tblout row. +_IDX_TARGET_NAME = 1 +_IDX_TARGET_ACC = 2 +_IDX_QUERY_NAME = 3 +_IDX_CLAN = 5 +_IDX_MDL_FROM = 7 +_IDX_MDL_TO = 8 +_IDX_SEQ_FROM = 9 +_IDX_SEQ_TO = 10 +_IDX_STRAND = 11 +_IDX_TRUNC = 12 +_IDX_GC = 14 +_IDX_SCORE = 16 +_IDX_EVALUE = 17 +_IDX_INC = 18 +_IDX_OLP = 19 +# fields 20-25 are the overlap detail columns, 26 is mdl len and 27 is seq len; +# everything from field 28 on is the free-text description +_N_FIXED_FIELDS = 28 + +# tRNA and tmRNA are already annotated by tRNAscan-SE and ARAGORN respectively. +# Reporting them again from Rfam produces duplicate features in the GFF, and the +# specialised tools are more sensitive for phage sequence (Rfam's RF00023 misses +# phage tmRNAs that ARAGORN finds). +TRNA_TMRNA_ACCESSIONS = {"RF00005", "RF00023"} + +NCRNA_TSV_COLUMNS = [ + "contig", + "locus_tag", + "start", + "stop", + "strand", + "rfam_acc", + "rfam_id", + "type", + "description", + "clan", + "bitscore", + "evalue", + "gc", + "trunc", + "mdl_from", + "mdl_to", +] + + +# Rfam's free-text type strings (e.g. 'Cis-reg; riboswitch;') mapped onto the +# INSDC/GenBank ncRNA_class controlled vocabulary. Checked in order, first +# match wins, so more specific terms must come first. Anything unmatched +# becomes "other", which is a permitted INSDC value. +# NB: needles must be lowercase - they are matched against a lowercased type. +_NCRNA_CLASS_RULES = [ + ("snorna", "snoRNA"), + ("snrna", "snRNA"), + ("mirna", "miRNA"), + ("ribozyme", "ribozyme"), + ("antisense", "antisense_RNA"), + ("tmrna", "tmRNA"), + ("srp", "SRP_RNA"), + ("rnasep", "RNase_P_RNA"), + ("telomerase", "telomerase_RNA"), + ("intron", "autocatalytically_spliced_intron"), + ("lncrna", "lncRNA"), + ("srna", "ncRNA"), + ("vault", "vault_RNA"), + ("y_rna", "Y_RNA"), +] + + +def rfam_type_to_ncrna_class(rfam_type): + """Maps an Rfam type string onto an INSDC ncRNA_class value. + + NCBI requires ncRNA_class on every ncRNA feature, and only accepts terms + from a fixed vocabulary. Rfam's own type strings are free text and much + broader (riboswitches, leaders, thermoregulators, frameshift elements), + none of which have an ncRNA_class - those legitimately fall through to + "other", with the specific Rfam family retained in the note attribute. + """ + if not rfam_type: + return "other" + + lowered = rfam_type.lower() + for needle, ncrna_class in _NCRNA_CLASS_RULES: + if needle in lowered: + return ncrna_class + + return "other" + + +def load_rfam_metadata(db_dir): + """Reads Rfam_metadata.tsv from the pharokka database directory. + + :param db_dir: pharokka database directory + :return: dict keyed by Rfam accession (e.g. 'RF00023') + """ + path = os.path.join(db_dir, "Rfam_metadata.tsv") + + metadata = {} + df = pl.read_csv(path, separator="\t", has_header=True) + for row in df.iter_rows(named=True): + metadata[row["rfam_acc"]] = { + "rfam_id": row.get("rfam_id", ""), + "type": row.get("type", ""), + "description": row.get("description", ""), + "clan_acc": row.get("clan_acc", ""), + } + + return metadata + + +def _empty_ncrna_df(): + """An empty dataframe with the ncRNA schema, so downstream code is uniform.""" + return pl.DataFrame( + { + "contig": pl.Series([], dtype=pl.Utf8), + "locus_tag": pl.Series([], dtype=pl.Utf8), + "start": pl.Series([], dtype=pl.Int64), + "stop": pl.Series([], dtype=pl.Int64), + "strand": pl.Series([], dtype=pl.Utf8), + "rfam_acc": pl.Series([], dtype=pl.Utf8), + "rfam_id": pl.Series([], dtype=pl.Utf8), + "type": pl.Series([], dtype=pl.Utf8), + "description": pl.Series([], dtype=pl.Utf8), + "clan": pl.Series([], dtype=pl.Utf8), + "bitscore": pl.Series([], dtype=pl.Float64), + "evalue": pl.Series([], dtype=pl.Float64), + "gc": pl.Series([], dtype=pl.Float64), + "trunc": pl.Series([], dtype=pl.Utf8), + "mdl_from": pl.Series([], dtype=pl.Int64), + "mdl_to": pl.Series([], dtype=pl.Int64), + } + ) + + +def parse_cmscan_tblout(tblout_path, metadata=None, keep_trna=False): + """Parses a ``cmscan --fmt 2`` tblout into a tidy polars dataframe. + + Three filters are applied, in order: + + 1. ``inc == '!'`` - the hit met the family's GA gathering threshold. + 2. ``olp != '='`` - drop hits marked as overlapping a higher-scoring hit + from the same clan. This is the clan competition step; without it, + clans such as the riboswitches emit piles of redundant overlapping + calls for the same locus. + 3. unless ``keep_trna``, drop tRNA/tmRNA families already covered by + tRNAscan-SE and ARAGORN. + + :param tblout_path: path to the cmscan tblout + :param metadata: dict from load_rfam_metadata(), or None + :param keep_trna: keep RF00005/RF00023 hits + :return: polars dataframe with NCRNA_TSV_COLUMNS (locus_tag left empty) + """ + metadata = metadata or {} + + if not os.path.isfile(tblout_path): + logger.warning(f"cmscan output {tblout_path} not found - no ncRNAs reported.") + return _empty_ncrna_df() + + records = [] + with open(tblout_path) as fh: + for line in fh: + line = line.rstrip("\n") + if not line or line.startswith("#"): + continue + + fields = line.split(None, _N_FIXED_FIELDS) + if len(fields) <= _IDX_OLP: + logger.warning(f"Skipping malformed cmscan line: {line[:80]}") + continue + + if fields[_IDX_INC] != "!": + continue + if fields[_IDX_OLP] == "=": + continue + + rfam_acc = fields[_IDX_TARGET_ACC] + if not keep_trna and rfam_acc in TRNA_TMRNA_ACCESSIONS: + continue + + # on the minus strand cmscan reports seq from > seq to + seq_from = int(fields[_IDX_SEQ_FROM]) + seq_to = int(fields[_IDX_SEQ_TO]) + start, stop = min(seq_from, seq_to), max(seq_from, seq_to) + + clan = fields[_IDX_CLAN] + info = metadata.get(rfam_acc, {}) + description = ( + fields[_N_FIXED_FIELDS] if len(fields) > _N_FIXED_FIELDS else "" + ) + + records.append( + { + "contig": fields[_IDX_QUERY_NAME], + "locus_tag": "", + "start": start, + "stop": stop, + "strand": fields[_IDX_STRAND], + "rfam_acc": rfam_acc, + "rfam_id": info.get("rfam_id") or fields[_IDX_TARGET_NAME], + "type": info.get("type", ""), + "description": info.get("description") or description, + "clan": "" if clan == "-" else clan, + "bitscore": float(fields[_IDX_SCORE]), + "evalue": float(fields[_IDX_EVALUE]), + "gc": float(fields[_IDX_GC]), + "trunc": fields[_IDX_TRUNC], + "mdl_from": int(fields[_IDX_MDL_FROM]), + "mdl_to": int(fields[_IDX_MDL_TO]), + } + ) + + if not records: + return _empty_ncrna_df() + + df = pl.DataFrame(records, schema=_empty_ncrna_df().schema) + return df.sort(["contig", "start"]) + + +def add_locus_tags(df, locustag, contig_count): + """Assigns pharokka locus tags to ncRNA rows. + + Follows the tRNA convention in post_processing.create_gff(): per-contig + numbering when there are multiple contigs, otherwise a single run of + numbers prefixed with the locustag. + """ + if df.height == 0: + return df + + if contig_count > 1: + df = df.with_columns( + ( + pl.col("contig") + + pl.lit("_ncRNA_") + + (pl.col("contig").cum_count().over("contig")).cast(pl.Utf8) + ).alias("locus_tag") + ) + else: + df = df.with_columns( + ( + pl.lit(f"{locustag}_ncRNA_") + + (pl.int_range(1, pl.len() + 1)).cast(pl.Utf8) + ).alias("locus_tag") + ) + + return df + + +def write_ncrna_tsv(df, out_dir, prefix): + """Writes the {prefix}_ncrna.tsv output.""" + out_path = os.path.join(out_dir, f"{prefix}_ncrna.tsv") + df.select(NCRNA_TSV_COLUMNS).write_csv(out_path, separator="\t") + logger.info(f"{df.height} ncRNA(s) written to {out_path}") diff --git a/src/pharokka/run.py b/src/pharokka/run.py index f647e13..aea54d1 100644 --- a/src/pharokka/run.py +++ b/src/pharokka/run.py @@ -15,7 +15,7 @@ from loguru import logger from .custom_db import run_custom_pyhmmer -from .databases import check_db_installation +from .databases import check_db_installation, check_rfam_installation from .hmm import run_pyhmmer from .input_commands import ( check_dependencies, @@ -37,6 +37,7 @@ convert_gff_to_gbk, reorient_terminase, run_aragorn, + run_cmscan, run_dnaapler, run_mash_dist, run_mash_sketch, @@ -53,6 +54,7 @@ split_input_fasta, translate_fastas, ) +from .rfam import load_rfam_metadata, parse_cmscan_tblout, write_ncrna_tsv from .util import count_contigs, get_version # suppress biopython deprecation warning @@ -143,6 +145,13 @@ def main(): "The database directory was unsuccessfully checked. Please run pharokka install." ) + # Rfam is only required for --rfam, so it is checked separately. Doing it + # here means a missing Rfam database fails immediately rather than after + # the gene prediction and MMseqs2 steps have already run. + if args.rfam is True: + if check_rfam_installation(db_dir) is True: + logger.info("Rfam database found.") + ### custom hmm custom_hmm_flag = False @@ -163,7 +172,8 @@ def main(): trna_version, aragorn_version, minced_version, - ) = check_dependencies(args.skip_mash) + infernal_version, + ) = check_dependencies(args.skip_mash, args.rfam) # instantiation/checking fasta and gene_predictor if args.genbank is True: @@ -358,6 +368,19 @@ def main(): run_minced(input_fasta, out_dir, prefix, args.minced_args, logdir) run_aragorn(input_fasta, out_dir, prefix, logdir) + # ncRNA annotation with Infernal against Rfam - opt in, as it roughly + # doubles the runtime for a small phage genome + ncrna_df = None + if args.rfam is True: + run_cmscan(input_fasta, out_dir, prefix, db_dir, args.threads, logdir) + # locus tags are assigned later, in Pharok.create_gff(), because the + # random locustag prefix is only resolved there + ncrna_df = parse_cmscan_tblout( + os.path.join(out_dir, prefix + "_cmscan.tblout"), + metadata=load_rfam_metadata(db_dir), + keep_trna=args.rfam_keep_trna, + ) + # running mmseqs2 on the 3 databases if mmseqs_flag is True: logger.info("Starting MMseqs2.") @@ -435,8 +458,12 @@ def main(): pharok.trna_version = trna_version pharok.aragorn_version = aragorn_version pharok.minced_version = minced_version + pharok.infernal_version = infernal_version pharok.skip_extra_annotations = args.skip_extra_annotations pharok.reverse_mmseqs2 = args.reverse_mmseqs2 + pharok.rfam_flag = args.rfam + if ncrna_df is not None: + pharok.ncrna_df = ncrna_df if pharok.hmm_flag is True: pharok.pyhmmer_results_dict = best_results_pyhmmer @@ -464,6 +491,10 @@ def main(): # create gff and save locustag to class for table pharok.create_gff() + # written after create_gff(), which is where ncRNA locus tags are assigned + if args.rfam is True: + write_ncrna_tsv(pharok.ncrna_df, out_dir, prefix) + # create table pharok.create_tbl() diff --git a/src/pharokka/version.py b/src/pharokka/version.py index 83b8f26..f84c53b 100644 --- a/src/pharokka/version.py +++ b/src/pharokka/version.py @@ -1 +1 @@ -__version__ = "1.10.2" +__version__ = "1.11.0" diff --git a/tests/test_data/rfam/Rfam.clanin b/tests/test_data/rfam/Rfam.clanin new file mode 100644 index 0000000..3c726dc --- /dev/null +++ b/tests/test_data/rfam/Rfam.clanin @@ -0,0 +1 @@ +CL00001 tmRNA tRNA diff --git a/tests/test_data/rfam/Rfam.cm b/tests/test_data/rfam/Rfam.cm new file mode 100644 index 0000000..5ce4fde --- /dev/null +++ b/tests/test_data/rfam/Rfam.cm @@ -0,0 +1,6732 @@ +INFERNAL1/a [1.1.5 | Sep 2023] +NAME SprX +ACC RF02672 +DESC Small pathogenicity island RNA X +STATES 477 +NODES 129 +CLEN 151 +W 170 +ALPH RNA +RF no +CONS yes +MAP yes +DATE Sat Jul 13 00:01:10 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF02672/CM +PBEGIN 0.05 +PEND 0.05 +WBETA 1e-07 +QDBBETA1 1e-07 +QDBBETA2 1e-15 +N2OMEGA 1.52588e-05 +N3OMEGA 1.52588e-05 +ELSELF -0.08926734 +NSEQ 3 +EFFN 0.852539 +CKSUM 2264962918 +NULL 0.000 0.000 0.000 0.000 +GA 80.00 +TC 109.50 +NC 55.50 +EFP7GF -3.7639 0.71796 +ECMLC 0.75727 -7.38512 0.39948 1600000 435878 0.002753 +ECMGC 0.35683 -21.27424 -11.40748 1600000 13524 0.029577 +ECMLI 0.58381 -8.86101 1.01995 1600000 384107 0.003124 +ECMGI 0.40408 -11.80463 -3.08524 1600000 13559 0.029501 +CM + [ ROOT 0 ] - - - - - - + S 0 -1 0 1 4 0 1 170 192 -6.421 -6.628 -0.077 -5.042 + IL 1 1 2 1 4 50 92 174 196 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 2 2 3 2 3 50 92 173 195 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 1 ] 1 - A - - - + ML 3 2 3 5 3 49 91 170 192 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 4 2 3 5 3 46 88 169 191 -6.174 -1.687 -0.566 + IL 5 5 3 5 3 49 91 172 194 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 2 ] 2 - C - - - + ML 6 5 3 8 3 48 90 169 191 -7.910 -0.025 -6.227 -0.680 1.142 -1.440 -0.321 + D 7 5 3 8 3 46 88 168 190 -5.620 -0.734 -1.403 + IL 8 8 3 8 3 48 90 170 192 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 3 ] - 151 - U - - + MR 9 8 3 11 3 47 89 168 190 -7.910 -0.025 -6.227 -0.661 -0.821 -1.334 1.266 + D 10 8 3 11 3 44 86 167 188 -6.390 -1.568 -0.620 + IR 11 11 3 11 3 47 89 169 191 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 4 ] - 150 - U - - + MR 12 11 3 14 3 46 88 167 189 -7.910 -0.025 -6.227 -0.661 -0.821 -1.334 1.266 + D 13 11 3 14 3 44 86 166 188 -6.390 -1.568 -0.620 + IR 14 14 3 14 3 46 88 168 190 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 5 ] - 149 - U - - + MR 15 14 3 17 3 45 87 166 188 -7.910 -0.025 -6.227 -0.661 -0.821 -1.334 1.266 + D 16 14 3 17 3 43 85 165 187 -6.390 -1.568 -0.620 + IR 17 17 3 17 3 45 87 167 189 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 6 ] - 148 - U - - + MR 18 17 3 20 2 44 86 165 187 -7.756 -0.007 -0.661 -0.821 -1.334 1.266 + D 19 17 3 20 2 43 85 164 186 -4.432 -0.068 + IR 20 20 3 20 2 44 86 166 188 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 7 ] - - - - - - + B 21 20 3 22 271 43 85 164 186 + [ BEGL 8 ] - - - - - - + S 22 21 1 23 1 7 35 97 118 0.000 + [ BIF 9 ] - - - - - - + B 23 22 1 24 119 7 35 97 118 + [ BEGL 10 ] - - - - - - + S 24 23 1 25 4 0 3 47 67 -0.053 -6.591 -5.999 -6.639 + [ MATP 11 ] 3 33 a u - - + MP 25 24 1 29 6 2 5 47 67 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 26 24 1 29 6 1 1 46 65 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 27 24 1 29 6 1 1 45 65 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 28 24 1 29 6 0 0 43 63 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 29 29 5 29 6 1 2 47 66 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 30 30 6 30 5 1 2 46 66 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 12 ] 4 32 C G - - + MP 31 30 6 35 6 2 4 45 65 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 32 30 6 35 6 1 1 44 64 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 33 30 6 35 6 1 1 44 64 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 34 30 6 35 6 0 0 42 62 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 35 35 5 35 6 1 2 45 64 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 36 36 6 36 5 1 2 44 64 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 13 ] 5 31 a u - - + MP 37 36 6 41 4 2 3 43 63 -6.421 -6.628 -0.077 -5.042 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 38 36 6 41 4 1 1 43 63 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 39 36 6 41 4 1 1 43 63 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 40 36 6 41 4 0 0 42 62 -4.568 -4.250 -2.265 -0.520 + IL 41 41 5 41 4 1 1 44 64 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 42 42 6 42 3 1 1 44 63 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 14 ] 6 - U - - - + ML 43 42 6 45 3 1 1 40 60 -7.910 -0.025 -6.227 -0.661 -0.821 -1.334 1.266 + D 44 42 6 45 3 0 0 39 59 -5.620 -0.734 -1.403 + IL 45 45 3 45 3 1 1 41 61 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 15 ] - 30 - U - - + MR 46 45 3 48 5 1 1 39 59 -6.683 -0.052 -6.498 -6.710 -7.602 -0.661 -0.821 -1.334 1.266 + D 47 45 3 48 5 0 0 38 58 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 48 48 3 48 5 1 1 40 59 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 16 ] 7 29 G C - - + MP 49 48 3 53 4 2 2 38 58 -6.421 -6.628 -0.077 -5.042 -3.828 -2.668 -3.883 0.773 -3.945 -4.296 0.483 -4.026 -3.666 3.306 -4.076 -0.353 0.062 -3.853 -1.515 -2.774 + ML 50 48 3 53 4 1 1 39 58 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 51 48 3 53 4 1 1 38 58 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 52 48 3 53 4 0 0 37 57 -4.568 -4.250 -2.265 -0.520 + IL 53 53 5 53 4 1 1 40 60 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 54 54 6 54 3 1 1 39 59 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 17 ] 8 - C - - - + ML 55 54 6 57 3 1 1 36 55 -7.910 -0.171 -3.216 -0.680 1.142 -1.440 -0.321 + D 56 54 6 57 3 0 0 35 54 -5.620 -0.734 -1.403 + IL 57 57 3 57 3 1 1 37 56 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 18 ] - 28 - c - - + MR 58 57 3 60 3 1 1 35 54 -7.767 -0.028 -6.085 -0.397 0.894 -1.132 -0.111 + D 59 57 3 60 3 0 0 33 52 -7.047 -2.225 -0.361 + IR 60 60 3 60 3 1 1 36 55 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 19 ] - 27 - U - - + MR 61 60 3 63 3 1 1 34 53 -7.767 -0.028 -6.085 -0.417 -0.643 -1.063 1.092 + D 62 60 3 63 3 0 0 32 51 -7.047 -2.225 -0.361 + IR 63 63 3 63 3 1 1 35 54 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 20 ] - 26 - A - - + MR 64 63 3 66 3 1 1 33 52 -7.767 -0.028 -6.085 1.245 -1.165 -0.906 -0.620 + D 65 63 3 66 3 0 0 31 50 -7.047 -2.225 -0.361 + IR 66 66 3 66 3 1 1 34 53 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 21 ] - 25 - U - - + MR 67 66 3 69 3 1 1 32 51 -7.767 -0.028 -6.085 -0.417 -0.643 -1.063 1.092 + D 68 66 3 69 3 0 0 31 50 -7.047 -0.786 -1.277 + IR 69 69 3 69 3 1 1 33 52 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 22 ] - 24 - C - - + MR 70 69 3 72 5 1 1 31 50 -6.683 -0.052 -6.498 -6.710 -7.602 -0.680 1.142 -1.440 -0.321 + D 71 69 3 72 5 0 0 30 49 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 72 72 3 72 5 1 1 31 50 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 23 ] 9 23 a u - - + MP 73 72 3 77 6 2 2 30 49 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 74 72 3 77 6 1 1 29 48 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 75 72 3 77 6 1 1 29 48 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 76 72 3 77 6 0 0 27 46 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 77 77 5 77 6 1 1 30 49 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 78 78 6 78 5 1 1 29 48 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 24 ] 10 22 u a - - + MP 79 78 6 83 4 2 2 28 47 -6.421 -6.628 -0.077 -5.042 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 80 78 6 83 4 1 1 28 48 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 81 78 6 83 4 1 1 28 47 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 82 78 6 83 4 0 0 27 46 -4.568 -4.250 -2.265 -0.520 + IL 83 83 5 83 4 1 1 30 49 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 84 84 6 84 3 1 1 29 48 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 25 ] 11 - C - - - + ML 85 84 6 87 3 1 1 25 44 -7.910 -0.025 -6.227 -0.680 1.142 -1.440 -0.321 + D 86 84 6 87 3 0 0 24 43 -5.620 -0.734 -1.403 + IL 87 87 3 87 3 1 1 26 45 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 26 ] - 21 - C - - + MR 88 87 3 90 3 1 1 24 43 -7.910 -0.025 -6.227 -0.680 1.142 -1.440 -0.321 + D 89 87 3 90 3 0 0 23 41 -6.390 -1.568 -0.620 + IR 90 90 3 90 3 1 1 25 44 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 27 ] - 20 - A - - + MR 91 90 3 93 5 1 1 23 42 -6.683 -0.052 -6.498 -6.710 -7.602 1.408 -1.442 -1.164 -0.909 + D 92 90 3 93 5 0 0 22 41 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 93 93 3 93 5 1 1 23 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 28 ] 12 19 a u - - + MP 94 93 3 98 6 2 2 22 41 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 95 93 3 98 6 1 1 21 40 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 96 93 3 98 6 1 1 21 40 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 97 93 3 98 6 0 0 20 38 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 98 98 5 98 6 1 1 22 41 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 99 99 6 99 5 1 1 22 40 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 29 ] 13 18 a u - - + MP 100 99 6 104 4 2 2 20 39 -6.421 -6.628 -0.077 -5.042 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 101 99 6 104 4 1 1 21 40 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 102 99 6 104 4 1 1 20 39 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 103 99 6 104 4 0 0 19 38 -4.568 -4.250 -2.265 -0.520 + IL 104 104 5 104 4 1 1 22 41 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 105 105 6 105 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 30 ] 14 - C - - - + ML 106 105 6 108 3 1 1 17 35 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 107 105 6 108 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 108 108 3 108 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 31 ] 15 - U - - - + ML 109 108 3 111 3 1 1 15 34 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 110 108 3 111 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 111 111 3 111 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 32 ] 16 - A - - - + ML 112 111 3 114 3 1 1 13 32 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 113 111 3 114 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 114 114 3 114 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 33 ] 17 - U - - - + ML 115 114 3 117 2 1 1 1 1 * 0.000 -0.661 -0.821 -1.334 1.266 + D 116 114 3 117 2 0 0 0 0 * 0.000 + IL 117 117 3 117 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 34 ] - - - - - - + E 118 117 3 -1 0 0 0 0 0 + [ BEGR 35 ] - - - - - - + S 119 23 1 120 3 0 9 64 84 -7.482 -0.029 -6.137 + IL 120 120 2 120 3 1 10 67 87 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 36 ] 34 - U - - - + ML 121 120 2 123 2 1 9 64 84 -7.756 -0.007 -0.661 -0.821 -1.334 1.266 + D 122 120 2 123 2 0 8 63 83 -8.445 -0.004 + IL 123 123 3 123 2 1 9 65 85 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 37 ] - - - - - - + B 124 123 3 125 193 0 8 63 83 + [ BEGL 38 ] - - - - - - + S 125 124 1 126 4 0 0 37 56 -0.053 -6.591 -5.999 -6.639 + [ MATP 39 ] 35 56 C G - - + MP 126 125 1 130 6 2 2 37 56 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 127 125 1 130 6 1 1 35 54 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 128 125 1 130 6 1 1 35 54 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 129 125 1 130 6 0 0 33 52 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 130 130 5 130 6 1 1 36 56 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 131 131 6 131 5 1 1 36 55 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 40 ] 36 55 a u - - + MP 132 131 6 136 6 2 2 35 54 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 133 131 6 136 6 1 1 33 52 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 134 131 6 136 6 1 1 33 52 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 135 131 6 136 6 0 0 31 50 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 136 136 5 136 6 1 1 34 54 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 137 137 6 137 5 1 1 34 53 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 41 ] 37 54 C G - - + MP 138 137 6 142 6 2 2 33 52 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 139 137 6 142 6 1 1 31 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 140 137 6 142 6 1 1 31 50 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 141 137 6 142 6 0 0 29 48 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 142 142 5 142 6 1 1 32 52 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 143 143 6 143 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 42 ] 38 53 C G - - + MP 144 143 6 148 6 2 2 31 50 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 145 143 6 148 6 1 1 29 49 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 146 143 6 148 6 1 1 29 49 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 147 143 6 148 6 0 0 27 46 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 148 148 5 148 6 1 1 30 50 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 149 149 6 149 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 43 ] 39 52 C G - - + MP 150 149 6 154 6 2 2 29 48 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 151 149 6 154 6 1 1 28 47 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 152 149 6 154 6 1 1 28 47 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 153 149 6 154 6 0 0 26 45 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 154 154 5 154 6 1 1 29 48 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 155 155 6 155 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 44 ] 40 51 a u - - + MP 156 155 6 160 4 2 2 27 46 -6.421 -6.628 -0.077 -5.042 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 157 155 6 160 4 1 1 27 46 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 158 155 6 160 4 1 1 27 46 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 159 155 6 160 4 0 0 26 45 -4.568 -4.250 -2.265 -0.520 + IL 160 160 5 160 4 1 1 29 48 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 161 161 6 161 3 1 1 27 47 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 45 ] 41 - A - - - + ML 162 161 6 164 3 1 1 24 43 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 163 161 6 164 3 0 0 23 42 -6.174 -1.687 -0.566 + IL 164 164 3 164 3 1 1 26 46 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 46 ] 42 - G - - - + ML 165 164 3 167 3 1 1 23 42 -7.482 -0.029 -6.137 -0.585 -1.615 1.327 -1.005 + D 166 164 3 167 3 0 0 22 41 -6.174 -1.687 -0.566 + IL 167 167 3 167 3 1 1 25 44 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 47 ] 43 - C - - - + ML 168 167 3 170 3 1 1 22 40 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 169 167 3 170 3 0 0 20 39 -6.174 -1.687 -0.566 + IL 170 170 3 170 3 1 1 24 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 48 ] 44 - A - - - + ML 171 170 3 173 3 1 1 20 39 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 172 170 3 173 3 0 0 19 38 -6.174 -1.687 -0.566 + IL 173 173 3 173 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 49 ] 45 - U - - - + ML 174 173 3 176 3 1 1 19 38 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 175 173 3 176 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 176 176 3 176 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 50 ] 46 - G - - - + ML 177 176 3 179 3 1 1 18 37 -7.482 -0.029 -6.137 -0.585 -1.615 1.327 -1.005 + D 178 176 3 179 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 179 179 3 179 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 51 ] 47 - U - - - + ML 180 179 3 182 3 1 1 17 35 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 181 179 3 182 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 182 182 3 182 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 52 ] 48 - C - - - + ML 183 182 3 185 3 1 1 15 34 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 184 182 3 185 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 185 185 3 185 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 53 ] 49 - A - - - + ML 186 185 3 188 3 1 1 13 32 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 187 185 3 188 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 188 188 3 188 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 54 ] 50 - C - - - + ML 189 188 3 191 2 1 1 1 1 * 0.000 -0.680 1.142 -1.440 -0.321 + D 190 188 3 191 2 0 0 0 0 * 0.000 + IL 191 191 3 191 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 55 ] - - - - - - + E 192 191 3 -1 0 0 0 0 0 + [ BEGR 56 ] - - - - - - + S 193 124 1 194 5 0 0 40 59 -6.683 -0.052 -6.498 -6.710 -7.602 + IL 194 194 2 194 5 1 1 41 61 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 57 ] 57 81 u g - - + MP 195 194 2 199 6 2 2 40 59 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.255 -3.117 -3.138 0.462 -2.200 -3.706 2.058 -2.873 -3.173 0.833 -3.553 -1.134 1.355 -3.407 2.129 -2.088 + ML 196 194 2 199 6 1 1 39 59 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 197 194 2 199 6 1 1 39 58 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 198 194 2 199 6 0 0 37 57 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 199 199 5 199 6 1 1 40 59 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 200 200 6 200 5 1 1 40 59 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 58 ] 58 80 u a - - + MP 201 200 6 205 4 2 2 38 57 -6.421 -6.628 -0.077 -5.042 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 202 200 6 205 4 1 1 38 58 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 203 200 6 205 4 1 1 38 57 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 204 200 6 205 4 0 0 37 56 -4.568 -4.250 -2.265 -0.520 + IL 205 205 5 205 4 1 1 40 59 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 206 206 6 206 3 1 1 39 58 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 59 ] 59 - U - - - + ML 207 206 6 209 3 1 1 35 54 -7.910 -0.025 -6.227 -0.661 -0.821 -1.334 1.266 + D 208 206 6 209 3 0 0 34 53 -5.620 -0.734 -1.403 + IL 209 209 3 209 3 1 1 36 55 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 60 ] - 79 - U - - + MR 210 209 3 212 5 1 1 34 53 -6.683 -0.052 -6.498 -6.710 -7.602 -0.661 -0.821 -1.334 1.266 + D 211 209 3 212 5 0 0 33 52 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 212 212 3 212 5 1 1 35 54 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 61 ] 60 78 u a - - + MP 213 212 3 217 4 2 2 33 52 -6.388 -7.634 -0.114 -4.087 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 214 212 3 217 4 1 1 33 52 -2.408 -4.532 -1.293 -1.473 0.368 -0.385 -0.191 0.094 + MR 215 212 3 217 4 1 1 32 51 -4.102 -12.528 -0.390 -2.485 0.368 -0.385 -0.191 0.094 + D 216 212 3 217 4 0 0 31 49 -12.737 -14.007 -2.036 -0.404 + IL 217 217 5 217 4 1 1 33 52 -2.817 -4.319 -0.613 -2.698 0.000 0.000 0.000 0.000 + IR 218 218 6 218 3 1 1 33 52 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 62 ] - 77 - C - - + MR 219 218 6 221 5 1 1 31 50 -6.683 -0.052 -6.498 -6.710 -7.602 -0.680 1.142 -1.440 -0.321 + D 220 218 6 221 5 0 0 30 49 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 221 221 3 221 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 63 ] 61 76 u g - - + MP 222 221 3 226 6 2 2 30 49 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.255 -3.117 -3.138 0.462 -2.200 -3.706 2.058 -2.873 -3.173 0.833 -3.553 -1.134 1.355 -3.407 2.129 -2.088 + ML 223 221 3 226 6 1 1 29 48 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 224 221 3 226 6 1 1 29 48 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 225 221 3 226 6 0 0 26 45 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 226 226 5 226 6 1 1 30 49 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 227 227 6 227 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 64 ] 62 75 u a - - + MP 228 227 6 232 6 2 2 28 47 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 229 227 6 232 6 1 1 27 46 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 230 227 6 232 6 1 1 27 46 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 231 227 6 232 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 232 232 5 232 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 233 233 6 233 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 65 ] 63 74 C G - - + MP 234 233 6 238 6 2 2 26 45 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 235 233 6 238 6 1 1 25 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 236 233 6 238 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 237 233 6 238 6 0 0 23 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 238 238 5 238 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 239 239 6 239 5 1 1 26 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 66 ] 64 73 u a - - + MP 240 239 6 244 6 2 2 24 43 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 241 239 6 244 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 242 239 6 244 6 1 1 23 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 243 239 6 244 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 244 244 5 244 6 1 1 24 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 245 245 6 245 5 1 1 24 43 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 67 ] 65 72 u g - - + MP 246 245 6 250 4 2 2 22 41 -6.421 -6.628 -0.077 -5.042 -3.255 -3.117 -3.138 0.462 -2.200 -3.706 2.058 -2.873 -3.173 0.833 -3.553 -1.134 1.355 -3.407 2.129 -2.088 + ML 247 245 6 250 4 1 1 23 42 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 248 245 6 250 4 1 1 22 41 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 249 245 6 250 4 0 0 21 40 -4.568 -4.250 -2.265 -0.520 + IL 250 250 5 250 4 1 1 24 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 251 251 6 251 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 68 ] 66 - A - - - + ML 252 251 6 254 3 1 1 19 38 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 253 251 6 254 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 254 254 3 254 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 69 ] 67 - u - - - + ML 255 254 3 257 3 1 1 18 37 -7.482 -0.029 -6.137 -0.361 0.006 -1.077 0.802 + D 256 254 3 257 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 257 257 3 257 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 70 ] 68 - G - - - + ML 258 257 3 260 3 1 1 17 35 -7.482 -0.029 -6.137 -0.585 -1.615 1.327 -1.005 + D 259 257 3 260 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 260 260 3 260 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 71 ] 69 - A - - - + ML 261 260 3 263 3 1 1 15 34 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 262 260 3 263 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 263 263 3 263 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 72 ] 70 - U - - - + ML 264 263 3 266 3 1 1 13 32 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 265 263 3 266 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 266 266 3 266 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 73 ] 71 - A - - - + ML 267 266 3 269 2 1 1 1 1 * 0.000 1.408 -1.442 -1.164 -0.909 + D 268 266 3 269 2 0 0 0 0 * 0.000 + IL 269 269 3 269 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 74 ] - - - - - - + E 270 269 3 -1 0 0 0 0 0 + [ BEGR 75 ] - - - - - - + S 271 21 1 272 3 0 17 83 103 -7.482 -0.029 -6.137 + IL 272 272 2 272 3 1 18 86 106 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 76 ] 82 - U - - - + ML 273 272 2 275 3 1 17 83 103 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 274 272 2 275 3 0 14 81 102 -6.174 -1.687 -0.566 + IL 275 275 3 275 3 1 17 85 105 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 77 ] 83 - U - - - + ML 276 275 3 278 3 1 16 82 102 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 277 275 3 278 3 0 13 80 101 -6.174 -1.687 -0.566 + IL 278 278 3 278 3 1 16 84 104 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 78 ] 84 - U - - - + ML 279 278 3 281 3 1 15 81 101 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 280 278 3 281 3 0 12 79 100 -6.174 -1.687 -0.566 + IL 281 281 3 281 3 1 15 82 103 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 79 ] 85 - U - - - + ML 282 281 3 284 3 1 14 80 100 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 283 281 3 284 3 0 12 78 99 -6.174 -1.687 -0.566 + IL 284 284 3 284 3 1 14 81 102 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 80 ] 86 - C - - - + ML 285 284 3 287 2 1 13 79 99 -7.756 -0.007 -0.680 1.142 -1.440 -0.321 + D 286 284 3 287 2 0 12 78 98 -8.445 -0.004 + IL 287 287 3 287 2 1 13 80 100 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 81 ] - - - - - - + B 288 287 3 289 351 0 12 78 98 + [ BEGL 82 ] - - - - - - + S 289 288 1 290 4 0 0 34 53 -0.053 -6.591 -5.999 -6.639 + [ MATP 83 ] 87 106 a u - - + MP 290 289 1 294 6 2 2 34 53 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 291 289 1 294 6 1 1 33 52 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 292 289 1 294 6 1 1 33 52 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 293 289 1 294 6 0 0 30 49 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 294 294 5 294 6 1 1 34 53 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 295 295 6 295 5 1 1 34 53 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 84 ] 88 105 u a - - + MP 296 295 6 300 6 2 2 32 51 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 297 295 6 300 6 1 1 31 50 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 298 295 6 300 6 1 1 31 50 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 299 295 6 300 6 0 0 28 47 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 300 300 5 300 6 1 1 32 51 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 301 301 6 301 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 85 ] 89 104 a u - - + MP 302 301 6 306 6 2 2 30 49 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 303 301 6 306 6 1 1 29 48 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 304 301 6 306 6 1 1 29 48 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 305 301 6 306 6 0 0 26 45 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 306 306 5 306 6 1 1 30 49 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 307 307 6 307 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 86 ] 90 103 C G - - + MP 308 307 6 312 6 2 2 28 47 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 309 307 6 312 6 1 1 27 46 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 310 307 6 312 6 1 1 27 46 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 311 307 6 312 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 312 312 5 312 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 313 313 6 313 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 87 ] 91 102 u a - - + MP 314 313 6 318 6 2 2 26 45 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 315 313 6 318 6 1 1 25 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 316 313 6 318 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 317 313 6 318 6 0 0 23 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 318 318 5 318 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 319 319 6 319 5 1 1 26 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 88 ] 92 101 a u - - + MP 320 319 6 324 6 2 2 24 43 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 321 319 6 324 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 322 319 6 324 6 1 1 23 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 323 319 6 324 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 324 324 5 324 6 1 1 24 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 325 325 6 325 5 1 1 24 43 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 89 ] 93 100 C G - - + MP 326 325 6 330 4 2 2 22 41 -6.421 -6.628 -0.077 -5.042 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 327 325 6 330 4 1 1 23 42 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 328 325 6 330 4 1 1 22 41 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 329 325 6 330 4 0 0 21 40 -4.568 -4.250 -2.265 -0.520 + IL 330 330 5 330 4 1 1 24 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 331 331 6 331 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 90 ] 94 - U - - - + ML 332 331 6 334 3 1 1 19 38 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 333 331 6 334 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 334 334 3 334 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 91 ] 95 - C - - - + ML 335 334 3 337 3 1 1 18 37 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 336 334 3 337 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 337 337 3 337 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 92 ] 96 - C - - - + ML 338 337 3 340 3 1 1 17 35 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 339 337 3 340 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 340 340 3 340 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 93 ] 97 - C - - - + ML 341 340 3 343 3 1 1 15 34 -7.482 -0.193 -3.062 -0.680 1.142 -1.440 -0.321 + D 342 340 3 343 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 343 343 3 343 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 94 ] 98 - u - - - + ML 344 343 3 346 3 1 1 13 32 -7.322 -0.032 -5.976 -0.222 0.182 -0.932 0.569 + D 345 343 3 346 3 0 0 13 31 -6.939 -0.751 -1.330 + IL 346 346 3 346 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 95 ] 99 - C - - - + ML 347 346 3 349 2 1 1 1 1 * 0.000 -0.680 1.142 -1.440 -0.321 + D 348 346 3 349 2 0 0 0 0 * 0.000 + IL 349 349 3 349 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 96 ] - - - - - - + E 350 349 3 -1 0 0 0 0 0 + [ BEGR 97 ] - - - - - - + S 351 288 1 352 3 0 1 57 77 -7.482 -0.029 -6.137 + IL 352 352 2 352 3 1 1 60 80 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 98 ] 107 - A - - - + ML 353 352 2 355 3 1 2 57 77 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 354 352 2 355 3 0 0 55 75 -6.174 -1.687 -0.566 + IL 355 355 3 355 3 1 1 59 79 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 99 ] 108 - U - - - + ML 356 355 3 358 3 1 1 56 76 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 357 355 3 358 3 0 0 54 74 -6.174 -1.687 -0.566 + IL 358 358 3 358 3 1 1 58 78 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 100 ] 109 - A - - - + ML 359 358 3 361 3 1 1 55 74 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 360 358 3 361 3 0 0 53 73 -6.174 -1.687 -0.566 + IL 361 361 3 361 3 1 1 57 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 101 ] 110 - U - - - + ML 362 361 3 364 3 1 1 54 73 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 363 361 3 364 3 0 0 52 72 -6.174 -1.687 -0.566 + IL 364 364 3 364 3 1 1 56 76 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 102 ] 111 - G - - - + ML 365 364 3 367 3 1 1 53 72 -7.482 -0.029 -6.137 -0.585 -1.615 1.327 -1.005 + D 366 364 3 367 3 0 0 51 71 -6.174 -1.687 -0.566 + IL 367 367 3 367 3 1 1 55 75 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 103 ] 112 - A - - - + ML 368 367 3 370 3 1 1 52 71 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 369 367 3 370 3 0 0 50 70 -6.174 -1.687 -0.566 + IL 370 370 3 370 3 1 1 54 73 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 104 ] 113 - C - - - + ML 371 370 3 373 3 1 1 50 70 -7.482 -0.029 -6.137 -0.680 1.142 -1.440 -0.321 + D 372 370 3 373 3 0 0 49 69 -6.174 -1.687 -0.566 + IL 373 373 3 373 3 1 1 52 72 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 105 ] 114 - U - - - + ML 374 373 3 376 3 1 1 49 69 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 375 373 3 376 3 0 0 48 68 -6.174 -1.687 -0.566 + IL 376 376 3 376 3 1 1 51 71 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 106 ] 115 - U - - - + ML 377 376 3 379 3 1 1 48 68 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 378 376 3 379 3 0 0 47 66 -6.174 -1.687 -0.566 + IL 379 379 3 379 3 1 1 50 70 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 107 ] 116 - U - - - + ML 380 379 3 382 5 1 1 47 67 -6.683 -0.052 -6.498 -6.710 -7.602 -0.661 -0.821 -1.334 1.266 + D 381 379 3 382 5 0 0 46 65 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 382 382 3 382 5 1 1 48 67 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 108 ] 117 147 a u - - + MP 383 382 3 387 6 2 2 46 66 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 384 382 3 387 6 1 1 45 64 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 385 382 3 387 6 1 1 45 64 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 386 382 3 387 6 0 0 42 62 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 387 387 5 387 6 1 1 46 65 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 388 388 6 388 5 1 1 46 65 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 109 ] 118 146 G C - - + MP 389 388 6 393 6 2 2 44 64 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.828 -2.668 -3.883 0.773 -3.945 -4.296 0.483 -4.026 -3.666 3.306 -4.076 -0.353 0.062 -3.853 -1.515 -2.774 + ML 390 388 6 393 6 1 1 43 62 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 391 388 6 393 6 1 1 43 62 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 392 388 6 393 6 0 0 40 60 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 393 393 5 393 6 1 1 44 63 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 394 394 6 394 5 1 1 44 63 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 110 ] 119 145 C G - - + MP 395 394 6 399 6 2 2 42 62 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 396 394 6 399 6 1 1 41 60 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 397 394 6 399 6 1 1 41 60 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 398 394 6 399 6 0 0 39 58 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 399 399 5 399 6 1 1 42 61 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 400 400 6 400 5 1 1 42 61 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 111 ] 120 144 a u - - + MP 401 400 6 405 6 2 2 40 60 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 402 400 6 405 6 1 1 39 59 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 403 400 6 405 6 1 1 39 59 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 404 400 6 405 6 0 0 37 57 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 405 405 5 405 6 1 1 40 59 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 406 406 6 406 5 1 1 40 59 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 112 ] 121 143 u g - - + MP 407 406 6 411 4 2 2 38 58 -6.421 -6.628 -0.077 -5.042 -3.255 -3.117 -3.138 0.462 -2.200 -3.706 2.058 -2.873 -3.173 0.833 -3.553 -1.134 1.355 -3.407 2.129 -2.088 + ML 408 406 6 411 4 1 1 39 58 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 409 406 6 411 4 1 1 38 58 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 410 406 6 411 4 0 0 37 57 -4.568 -4.250 -2.265 -0.520 + IL 411 411 5 411 4 1 1 40 59 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 412 412 6 412 3 1 1 39 58 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 113 ] 122 - U - - - + ML 413 412 6 415 5 1 1 36 55 -6.683 -0.052 -6.498 -6.710 -7.602 -0.661 -0.821 -1.334 1.266 + D 414 412 6 415 5 0 0 34 53 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 415 415 3 415 5 1 1 36 55 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 114 ] 123 142 C G - - + MP 416 415 3 420 6 2 2 35 54 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 417 415 3 420 6 1 1 33 52 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 418 415 3 420 6 1 1 33 52 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 419 415 3 420 6 0 0 31 50 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 420 420 5 420 6 1 1 34 53 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 421 421 6 421 5 1 1 34 53 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 115 ] 124 141 C G - - + MP 422 421 6 426 6 2 2 33 52 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 423 421 6 426 6 1 1 31 50 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 424 421 6 426 6 1 1 31 50 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 425 421 6 426 6 0 0 29 48 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 426 426 5 426 6 1 1 32 51 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 427 427 6 427 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 116 ] 125 140 C G - - + MP 428 427 6 432 6 2 2 31 50 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.677 -3.472 -3.500 0.193 -2.451 -4.020 3.140 -3.163 -3.533 0.628 -3.873 -1.407 1.132 -3.793 -0.149 -2.408 + ML 429 427 6 432 6 1 1 29 48 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 430 427 6 432 6 1 1 29 48 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 431 427 6 432 6 0 0 27 46 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 432 432 5 432 6 1 1 30 49 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 433 433 6 433 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 117 ] 126 139 G C - - + MP 434 433 6 438 6 2 2 29 48 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.828 -2.668 -3.883 0.773 -3.945 -4.296 0.483 -4.026 -3.666 3.306 -4.076 -0.353 0.062 -3.853 -1.515 -2.774 + ML 435 433 6 438 6 1 1 27 46 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 436 433 6 438 6 1 1 27 46 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 437 433 6 438 6 0 0 25 44 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 438 438 5 438 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 439 439 6 439 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 118 ] 127 138 u a - - + MP 440 439 6 444 6 2 2 27 46 -8.928 -8.868 -0.024 -7.644 -7.924 -8.319 -3.390 -3.149 -3.304 0.484 -2.444 -3.932 1.859 -3.071 -3.322 0.929 -3.728 -1.060 2.707 -3.559 -0.140 -2.210 + ML 441 439 6 444 6 1 1 26 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 442 439 6 444 6 1 1 26 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 443 439 6 444 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 444 444 5 444 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 445 445 6 445 5 1 1 26 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 119 ] 128 137 a u - - + MP 446 445 6 450 4 2 2 25 44 -6.421 -6.628 -0.077 -5.042 -3.168 -2.377 -3.217 2.642 -3.235 -4.272 1.038 -3.280 -3.144 1.787 -3.656 0.022 0.607 -3.567 -0.913 -2.096 + ML 447 445 6 450 4 1 1 25 44 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 448 445 6 450 4 1 1 25 44 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 449 445 6 450 4 0 0 24 43 -4.568 -4.250 -2.265 -0.520 + IL 450 450 5 450 4 1 1 26 46 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 451 451 6 451 3 1 1 25 44 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 120 ] 129 - U - - - + ML 452 451 6 454 3 1 1 22 40 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 453 451 6 454 3 0 0 20 39 -6.174 -1.687 -0.566 + IL 454 454 3 454 3 1 1 24 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 121 ] 130 - A - - - + ML 455 454 3 457 3 1 1 20 39 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 456 454 3 457 3 0 0 19 38 -6.174 -1.687 -0.566 + IL 457 457 3 457 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 122 ] 131 - A - - - + ML 458 457 3 460 3 1 1 19 38 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 459 457 3 460 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 460 460 3 460 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 123 ] 132 - u - - - + ML 461 460 3 463 3 1 1 18 37 -7.482 -0.029 -6.137 -0.361 0.006 -1.077 0.802 + D 462 460 3 463 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 463 463 3 463 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 124 ] 133 - A - - - + ML 464 463 3 466 3 1 1 17 35 -7.482 -0.029 -6.137 1.408 -1.442 -1.164 -0.909 + D 465 463 3 466 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 466 466 3 466 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 125 ] 134 - G - - - + ML 467 466 3 469 3 1 1 15 34 -7.482 -0.029 -6.137 -0.585 -1.615 1.327 -1.005 + D 468 466 3 469 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 469 469 3 469 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 126 ] 135 - U - - - + ML 470 469 3 472 3 1 1 13 32 -7.482 -0.029 -6.137 -0.661 -0.821 -1.334 1.266 + D 471 469 3 472 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 472 472 3 472 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 127 ] 136 - U - - - + ML 473 472 3 475 2 1 1 1 1 * 0.000 -0.661 -0.821 -1.334 1.266 + D 474 472 3 475 2 0 0 0 0 * 0.000 + IL 475 475 3 475 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 128 ] - - - - - - + E 476 475 3 -1 0 0 0 0 0 +// +HMMER3/f [3.4 | Aug 2023] +NAME SprX +ACC RF02672 +DESC Small pathogenicity island RNA X +LENG 151 +MAXL 271 +ALPH RNA +RF no +MM no +CONS yes +CS yes +MAP yes +DATE Sat Jul 13 00:01:10 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF02672/CM +NSEQ 3 +EFFN 0.963867 +CKSUM 2264962918 +STATS LOCAL MSV -9.8780 0.71796 +STATS LOCAL VITERBI -12.0858 0.71796 +STATS LOCAL FORWARD -3.2989 0.71796 +HMM A C G U + m->m m->i m->d i->m i->i d->m d->d + COMPO 1.43852 1.42109 1.49929 1.21073 + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 0.00000 * + 1 0.37548 2.45917 2.26006 2.09405 1 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 2 1.93538 0.54050 2.46900 1.66863 2 C - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 3 0.81811 1.98532 1.27517 1.95181 3 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 4 2.46816 0.52481 2.11334 1.59575 4 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 5 0.81842 1.98487 1.27542 1.95080 5 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 6 1.90845 2.00413 2.38073 0.47092 6 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 7 2.09698 2.38831 0.37078 2.35184 7 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 8 1.93538 0.54050 2.46900 1.66863 8 C - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 9 0.81996 1.98262 1.27666 1.94579 9 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 10 2.25714 1.42001 1.89271 0.68721 10 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 11 1.93538 0.54050 2.46900 1.66863 11 C - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 12 0.81939 1.98346 1.27620 1.94765 12 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 13 0.81893 1.98412 1.27583 1.94913 13 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 14 1.93538 0.54050 2.46900 1.66863 14 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 15 1.90845 2.00413 2.38073 0.47092 15 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 16 0.37548 2.45917 2.26006 2.09405 16 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 17 1.90845 2.00413 2.38073 0.47092 17 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 18 2.18558 1.49007 1.80457 0.69779 18 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 19 2.18571 1.49006 1.80459 0.69776 19 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 20 0.37548 2.45917 2.26006 2.09405 20 A - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 21 1.93538 0.54050 2.46900 1.66863 21 C - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 22 0.78840 2.06134 1.25510 2.01670 22 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 23 2.18430 1.49017 1.80434 0.69811 23 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 24 1.93538 0.54050 2.46900 1.66863 24 C - - - + 1.38629 1.38629 1.38629 1.38629 + 0.19054 3.51544 1.93967 1.46634 0.26236 1.09861 0.40547 + 25 1.72179 1.86452 2.17466 0.59305 25 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06948 3.39439 3.39439 1.46634 0.26236 1.92198 0.15820 + 26 0.48934 2.24589 2.06365 1.86987 26 A - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06948 3.39439 3.39439 1.46634 0.26236 1.92198 0.15820 + 27 1.72179 1.86452 2.17466 0.59305 27 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06948 3.39439 3.39439 1.46634 0.26236 1.92198 0.15820 + 28 1.71372 0.71522 2.22767 1.50084 28 c - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06948 3.39439 3.39439 1.46634 0.26236 0.34621 1.22883 + 29 2.58660 0.42594 2.21885 1.81504 29 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 30 1.90845 2.00413 2.38073 0.47092 30 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 31 2.18309 1.49027 1.80413 0.69841 31 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 32 1.86326 2.27218 0.45762 2.21676 32 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 33 2.17790 1.49069 1.80321 0.69970 33 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 34 1.90845 2.00413 2.38073 0.47092 34 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 35 2.47009 0.52434 2.11389 1.59597 35 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 36 0.81830 1.98505 1.27532 1.95120 36 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 37 2.46686 0.52512 2.11296 1.59560 37 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 38 2.46591 0.52535 2.11268 1.59550 38 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 39 2.46520 0.52552 2.11248 1.59542 39 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 40 0.81863 1.98456 1.27559 1.95010 40 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 41 0.37548 2.45917 2.26006 2.09405 41 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 42 1.86915 2.60057 0.41852 2.17601 42 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 43 1.93538 0.54050 2.46900 1.66863 43 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 44 0.37548 2.45917 2.26006 2.09405 44 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 45 1.90845 2.00413 2.38073 0.47092 45 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 46 1.86915 2.60057 0.41852 2.17601 46 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 47 1.90845 2.00413 2.38073 0.47092 47 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 48 1.93538 0.54050 2.46900 1.66863 48 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 49 0.37548 2.45917 2.26006 2.09405 49 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 50 1.93538 0.54050 2.46900 1.66863 50 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 51 2.18401 1.49019 1.80429 0.69818 51 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 52 1.86479 2.27339 0.45670 2.21880 52 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 53 1.86466 2.27329 0.45678 2.21863 53 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 54 1.86424 2.27296 0.45703 2.21807 54 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 55 2.18141 1.49040 1.80383 0.69883 55 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 56 1.86123 2.27056 0.45886 2.21402 56 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 57 2.26468 1.27020 1.94332 0.75049 57 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 58 2.26428 1.41930 1.89426 0.68561 58 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 59 1.90845 2.00413 2.38073 0.47092 59 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 60 2.25730 1.42000 1.89274 0.68718 60 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 61 2.24684 1.27292 1.93880 0.75422 61 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 62 2.25375 1.42035 1.89197 0.68798 62 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 63 2.45851 0.52715 2.11053 1.59466 63 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 64 2.25920 1.41981 1.89316 0.68675 64 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 65 2.26087 1.27078 1.94236 0.75128 65 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 66 0.37548 2.45917 2.26006 2.09405 66 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 67 1.66722 1.37573 2.16767 0.81164 67 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 68 1.86915 2.60057 0.41852 2.17601 68 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 69 0.37548 2.45917 2.26006 2.09405 69 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 70 1.90845 2.00413 2.38073 0.47092 70 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 71 0.37548 2.45917 2.26006 2.09405 71 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 72 1.69772 2.10613 0.57499 2.02132 72 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 73 0.78860 2.06099 1.25526 2.01600 73 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 74 1.86425 2.27296 0.45703 2.21808 74 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 75 0.78863 2.06093 1.25528 2.01589 75 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 76 1.69745 2.10593 0.57521 2.02096 76 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 77 1.93538 0.54050 2.46900 1.66863 77 C - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 78 0.78814 2.06178 1.25489 2.01757 78 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 79 1.90845 2.00413 2.38073 0.47092 79 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 80 0.78779 2.06239 1.25461 2.01879 80 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 81 1.70028 2.10806 0.57294 2.02473 81 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 82 1.90845 2.00413 2.38073 0.47092 82 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 83 1.90845 2.00413 2.38073 0.47092 83 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 84 1.90845 2.00413 2.38073 0.47092 84 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 85 1.90845 2.00413 2.38073 0.47092 85 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 86 1.93538 0.54050 2.46900 1.66863 86 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 87 0.81811 1.98532 1.27517 1.95181 87 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 88 2.26471 1.41926 1.89435 0.68551 88 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 89 0.81842 1.98487 1.27542 1.95080 89 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 90 2.46591 0.52535 2.11268 1.59550 90 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 91 2.26249 1.41948 1.89387 0.68601 91 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 92 0.81863 1.98456 1.27559 1.95010 92 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 93 2.46418 0.52577 2.11218 1.59530 93 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 94 1.90845 2.00413 2.38073 0.47092 94 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 95 1.93538 0.54050 2.46900 1.66863 95 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 96 1.93538 0.54050 2.46900 1.66863 96 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 97 1.93538 0.54050 2.46900 1.66863 97 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.19330 3.51544 1.92394 1.46634 0.26236 1.09861 0.40547 + 98 1.56344 1.24539 2.05891 0.98039 98 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06967 3.39181 3.39181 1.46634 0.26236 0.34163 1.23999 + 99 1.93538 0.54050 2.46900 1.66863 99 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 100 1.86470 2.27332 0.45675 2.21868 100 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 101 2.18401 1.49019 1.80429 0.69818 101 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 102 0.78846 2.06123 1.25515 2.01648 102 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 103 1.86466 2.27329 0.45678 2.21863 103 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 104 2.18309 1.49027 1.80413 0.69841 104 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 105 0.78887 2.06052 1.25547 2.01507 105 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 106 2.17790 1.49069 1.80321 0.69970 106 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 107 0.37548 2.45917 2.26006 2.09405 107 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 108 1.90845 2.00413 2.38073 0.47092 108 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 109 0.37548 2.45917 2.26006 2.09405 109 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 110 1.90845 2.00413 2.38073 0.47092 110 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 111 1.86915 2.60057 0.41852 2.17601 111 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 112 0.37548 2.45917 2.26006 2.09405 112 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 113 1.93538 0.54050 2.46900 1.66863 113 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 114 1.90845 2.00413 2.38073 0.47092 114 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 115 1.90845 2.00413 2.38073 0.47092 115 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 116 1.90845 2.00413 2.38073 0.47092 116 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 117 0.81897 1.98407 1.27586 1.94900 117 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 118 2.10034 2.39056 0.36937 2.35557 118 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 119 2.46409 0.52579 2.11216 1.59529 119 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 120 0.81867 1.98450 1.27562 1.94997 120 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 121 2.26254 1.27052 1.94278 0.75094 121 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 122 1.90845 2.00413 2.38073 0.47092 122 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 123 2.45953 0.52690 2.11083 1.59478 123 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 124 2.46214 0.52626 2.11159 1.59507 124 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 125 2.46319 0.52601 2.11190 1.59519 125 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 126 2.10047 2.39065 0.36932 2.35571 126 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 127 2.26125 1.41960 1.89360 0.68629 127 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 128 0.81875 1.98439 1.27569 1.94972 128 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 129 1.90845 2.00413 2.38073 0.47092 129 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 130 0.37548 2.45917 2.26006 2.09405 130 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 131 0.37548 2.45917 2.26006 2.09405 131 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 132 1.66722 1.37573 2.16767 0.81164 132 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 133 0.37548 2.45917 2.26006 2.09405 133 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 134 1.86915 2.60057 0.41852 2.17601 134 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 135 1.90845 2.00413 2.38073 0.47092 135 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 136 1.90845 2.00413 2.38073 0.47092 136 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 137 2.18309 1.49027 1.80413 0.69841 137 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 138 0.78864 2.06091 1.25529 2.01584 138 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 139 2.58016 0.42733 2.21686 1.81378 139 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 140 1.86297 2.27195 0.45780 2.21636 140 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 141 1.86144 2.27074 0.45873 2.21432 141 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 142 1.85851 2.26840 0.46051 2.21038 142 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 143 1.69788 2.10625 0.57486 2.02153 143 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 144 2.18315 1.49026 1.80414 0.69839 144 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 145 1.86378 2.27259 0.45731 2.21745 145 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 146 2.57704 0.42800 2.21589 1.81317 146 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 147 2.17670 1.49078 1.80299 0.70000 147 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 148 1.90845 2.00413 2.38073 0.47092 148 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 149 1.90845 2.00413 2.38073 0.47092 149 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 150 1.90845 2.00413 2.38073 0.47092 150 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06131 3.51544 3.51544 1.46634 0.26236 1.09861 0.40547 + 151 1.90845 2.00413 2.38073 0.47092 151 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03113 3.48526 * 1.46634 0.26236 0.00000 * +// +INFERNAL1/a [1.1.5 | Sep 2023] +NAME SprD +ACC RF01828 +DESC Small pathogenicity island RNA D +STATES 445 +NODES 109 +CLEN 142 +W 161 +ALPH RNA +RF no +CONS yes +MAP yes +DATE Wed Jul 10 07:50:53 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF01828/CM +PBEGIN 0.05 +PEND 0.05 +WBETA 1e-07 +QDBBETA1 1e-07 +QDBBETA2 1e-15 +N2OMEGA 1.52588e-05 +N3OMEGA 1.52588e-05 +ELSELF -0.08926734 +NSEQ 2 +EFFN 0.714844 +CKSUM 1886193695 +NULL 0.000 0.000 0.000 0.000 +GA 100.00 +TC 170.40 +NC 46.20 +EFP7GF -5.0520 0.71825 +ECMLC 0.67551 -8.14872 0.56409 1600000 431778 0.002779 +ECMGC 0.37289 -21.53583 -11.68786 1600000 15736 0.025419 +ECMLI 0.57173 -8.91268 1.19667 1600000 388451 0.003089 +ECMGI 0.37145 -14.17489 -4.26998 1600000 15845 0.025245 +CM + [ ROOT 0 ] - - - - - - + S 0 -1 0 1 3 0 1 161 182 -4.225 -14.694 -0.079 + IL 1 1 2 1 3 34 81 180 224 -0.610 -4.491 -1.736 0.000 0.000 0.000 0.000 + IR 2 2 3 2 2 33 80 163 184 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 1 ] - - - - - - + B 3 2 3 4 203 32 78 161 182 + [ BEGL 2 ] - - - - - - + S 4 3 1 5 1 0 18 81 101 0.000 + [ BIF 3 ] - - - - - - + B 5 4 1 6 71 0 18 81 101 + [ BEGL 4 ] - - - - - - + S 6 5 1 7 4 0 0 35 54 -0.054 -6.557 -5.965 -6.605 + [ MATP 5 ] 1 21 g c - - + MP 7 6 1 11 6 2 2 35 54 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.036 -2.117 -3.144 1.409 -3.366 -4.171 0.907 -3.254 -2.999 2.129 -3.500 1.953 0.541 -3.463 -1.029 -1.997 + ML 8 6 1 11 6 1 1 34 53 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 9 6 1 11 6 1 1 34 53 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 10 6 1 11 6 0 0 31 50 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 11 11 5 11 6 1 1 35 54 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 12 12 6 12 5 1 1 35 54 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 6 ] 2 20 G C - - + MP 13 12 6 17 6 2 2 33 52 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 14 12 6 17 6 1 1 32 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 15 12 6 17 6 1 1 32 51 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 16 12 6 17 6 0 0 29 48 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 17 17 5 17 6 1 1 33 52 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 18 18 6 18 5 1 1 33 52 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 7 ] 3 19 G C - - + MP 19 18 6 23 6 2 2 31 50 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 20 18 6 23 6 1 1 30 49 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 21 18 6 23 6 1 1 30 49 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 22 18 6 23 6 0 0 27 46 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 23 23 5 23 6 1 1 31 50 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 24 24 6 24 5 1 1 31 50 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 8 ] 4 18 C G - - + MP 25 24 6 29 6 2 2 29 48 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 26 24 6 29 6 1 1 28 47 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 27 24 6 29 6 1 1 28 47 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 28 24 6 29 6 0 0 25 44 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 29 29 5 29 6 1 1 29 48 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 30 30 6 30 5 1 1 29 48 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 9 ] 5 17 G C - - + MP 31 30 6 35 6 2 2 27 46 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 32 30 6 35 6 1 1 26 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 33 30 6 35 6 1 1 26 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 34 30 6 35 6 0 0 23 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 35 35 5 35 6 1 1 27 46 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 36 36 6 36 5 1 1 27 46 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 10 ] 6 16 c g - - + MP 37 36 6 41 6 2 2 25 44 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 38 36 6 41 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 39 36 6 41 6 1 1 24 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 40 36 6 41 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 41 41 5 41 6 1 1 25 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 42 42 6 42 5 1 1 25 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 11 ] 7 15 u a - - + MP 43 42 6 47 6 2 2 23 42 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 44 42 6 47 6 1 1 23 42 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 45 42 6 47 6 1 1 22 41 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 46 42 6 47 6 0 0 21 40 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 47 47 5 47 6 1 1 23 42 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 48 48 6 48 5 1 1 23 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 12 ] 8 14 c g - - + MP 49 48 6 53 4 2 2 21 40 -6.338 -6.545 -0.082 -4.959 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 50 48 6 53 4 1 1 22 41 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 51 48 6 53 4 1 1 21 40 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 52 48 6 53 4 0 0 20 39 -4.568 -4.250 -2.265 -0.520 + IL 53 53 5 53 4 1 1 23 42 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 54 54 6 54 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 13 ] 9 - U - - - + ML 55 54 6 57 3 1 1 18 37 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 56 54 6 57 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 57 57 3 57 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 14 ] 10 - C - - - + ML 58 57 3 60 3 1 1 17 35 -7.407 -0.030 -6.061 -0.541 1.031 -1.289 -0.216 + D 59 57 3 60 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 60 60 3 60 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 15 ] 11 - A - - - + ML 61 60 3 63 3 1 1 15 34 -7.407 -0.030 -6.061 1.335 -1.308 -1.041 -0.769 + D 62 60 3 63 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 63 63 3 63 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 16 ] 12 - A - - - + ML 64 63 3 66 3 1 1 13 32 -7.407 -0.030 -6.061 1.335 -1.308 -1.041 -0.769 + D 65 63 3 66 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 66 66 3 66 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 17 ] 13 - G - - - + ML 67 66 3 69 2 1 1 1 1 * 0.000 -0.445 -1.442 1.225 -0.838 + D 68 66 3 69 2 0 0 0 0 * 0.000 + IL 69 69 3 69 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 18 ] - - - - - - + E 70 69 3 -1 0 0 0 0 0 + [ BEGR 19 ] - - - - - - + S 71 5 1 72 3 0 5 59 79 -7.407 -0.030 -6.061 + IL 72 72 2 72 3 1 5 62 82 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 20 ] 22 - U - - - + ML 73 72 2 75 3 1 5 59 79 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 74 72 2 75 3 0 0 58 78 -6.174 -1.687 -0.566 + IL 75 75 3 75 3 1 4 61 81 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 21 ] 23 - U - - - + ML 76 75 3 78 3 1 5 58 78 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 77 75 3 78 3 0 0 57 76 -6.174 -1.687 -0.566 + IL 78 78 3 78 3 1 4 60 80 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 22 ] 24 - C - - - + ML 79 78 3 81 3 1 4 57 77 -7.407 -0.030 -6.061 -0.541 1.031 -1.289 -0.216 + D 80 78 3 81 3 0 0 55 75 -6.174 -1.687 -0.566 + IL 81 81 3 81 3 1 3 59 79 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 23 ] 25 - A - - - + ML 82 81 3 84 3 1 4 56 76 -7.407 -0.030 -6.061 1.335 -1.308 -1.041 -0.769 + D 83 81 3 84 3 0 0 54 74 -6.174 -1.687 -0.566 + IL 84 84 3 84 3 1 3 58 78 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 24 ] 26 - U - - - + ML 85 84 3 87 3 1 3 55 74 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 86 84 3 87 3 0 0 53 73 -6.174 -1.687 -0.566 + IL 87 87 3 87 3 1 2 57 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 25 ] 27 - U - - - + ML 88 87 3 90 5 1 3 54 73 -6.621 -0.054 -6.436 -6.648 -7.540 -0.544 -0.734 -1.204 1.188 + D 89 87 3 90 5 0 0 52 72 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 90 90 3 90 5 1 1 54 74 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 26 ] 28 64 u a - - + MP 91 90 3 95 6 2 4 53 72 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 92 90 3 95 6 1 1 51 71 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 93 90 3 95 6 1 1 51 71 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 94 90 3 95 6 0 0 49 69 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 95 95 5 95 6 1 1 52 72 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 96 96 6 96 5 1 1 52 72 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 27 ] 29 63 u a - - + MP 97 96 6 101 6 2 4 51 70 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 98 96 6 101 6 1 1 50 70 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 99 96 6 101 6 1 1 50 69 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 100 96 6 101 6 0 0 48 68 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 101 101 5 101 6 1 1 51 70 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 102 102 6 102 5 1 1 50 70 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 28 ] 30 62 u a - - + MP 103 102 6 107 4 2 2 49 68 -6.338 -6.545 -0.082 -4.959 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 104 102 6 107 4 1 1 49 69 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 105 102 6 107 4 1 1 48 68 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 106 102 6 107 4 0 0 47 67 -4.568 -4.250 -2.265 -0.520 + IL 107 107 5 107 4 1 1 50 70 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 108 108 6 108 3 1 1 49 69 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 29 ] 31 - U - - - + ML 109 108 6 111 3 1 1 46 65 -7.842 -0.027 -6.159 -0.544 -0.734 -1.204 1.188 + D 110 108 6 111 3 0 0 45 64 -5.620 -0.734 -1.403 + IL 111 111 3 111 3 1 1 47 66 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 30 ] - 61 - U - - + MR 112 111 3 114 5 1 1 45 64 -6.621 -0.054 -6.436 -6.648 -7.540 -0.544 -0.734 -1.204 1.188 + D 113 111 3 114 5 0 0 44 63 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 114 114 3 114 5 1 1 46 65 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 31 ] 32 60 a u - - + MP 115 114 3 119 6 2 2 44 63 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 116 114 3 119 6 1 1 43 62 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 117 114 3 119 6 1 1 43 62 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 118 114 3 119 6 0 0 41 60 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 119 119 5 119 6 1 1 44 63 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 120 120 6 120 5 1 1 44 63 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 32 ] 33 59 u a - - + MP 121 120 6 125 6 2 2 42 61 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 122 120 6 125 6 1 1 41 61 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 123 120 6 125 6 1 1 41 60 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 124 120 6 125 6 0 0 39 59 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 125 125 5 125 6 1 1 42 61 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 126 126 6 126 5 1 1 42 61 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 33 ] 34 58 g c - - + MP 127 126 6 131 4 2 2 40 59 -6.338 -6.545 -0.082 -4.959 -3.036 -2.117 -3.144 1.409 -3.366 -4.171 0.907 -3.254 -2.999 2.129 -3.500 1.953 0.541 -3.463 -1.029 -1.997 + ML 128 126 6 131 4 1 1 40 60 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 129 126 6 131 4 1 1 40 59 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 130 126 6 131 4 0 0 39 58 -4.568 -4.250 -2.265 -0.520 + IL 131 131 5 131 4 1 1 42 61 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 132 132 6 132 3 1 1 41 60 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 34 ] 35 - U - - - + ML 133 132 6 135 3 1 1 37 56 -7.842 -0.027 -6.159 -0.544 -0.734 -1.204 1.188 + D 134 132 6 135 3 0 0 36 55 -5.620 -0.734 -1.403 + IL 135 135 3 135 3 1 1 38 57 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 35 ] - 57 - U - - + MR 136 135 3 138 5 1 1 36 55 -6.621 -0.054 -6.436 -6.648 -7.540 -0.544 -0.734 -1.204 1.188 + D 137 135 3 138 5 0 0 35 54 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 138 138 3 138 5 1 1 37 56 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 36 ] 36 56 a u - - + MP 139 138 3 143 6 2 2 35 54 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 140 138 3 143 6 1 1 34 53 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 141 138 3 143 6 1 1 34 53 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 142 138 3 143 6 0 0 32 51 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 143 143 5 143 6 1 1 35 54 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 144 144 6 144 5 1 1 35 54 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 37 ] 37 55 c g - - + MP 145 144 6 149 6 2 2 33 52 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 146 144 6 149 6 1 1 32 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 147 144 6 149 6 1 1 32 51 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 148 144 6 149 6 0 0 30 49 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 149 149 5 149 6 1 1 33 52 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 150 150 6 150 5 1 1 33 52 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 38 ] 38 54 u a - - + MP 151 150 6 155 4 2 2 31 50 -6.315 -7.560 -0.120 -4.014 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 152 150 6 155 4 1 1 31 50 -2.408 -4.532 -1.293 -1.473 0.368 -0.385 -0.191 0.094 + MR 153 150 6 155 4 1 1 30 49 -4.102 -12.528 -0.390 -2.485 0.368 -0.385 -0.191 0.094 + D 154 150 6 155 4 0 0 29 48 -12.737 -14.007 -2.036 -0.404 + IL 155 155 5 155 4 1 1 31 50 -2.817 -4.319 -0.613 -2.698 0.000 0.000 0.000 0.000 + IR 156 156 6 156 3 1 1 31 50 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 39 ] - 53 - U - - + MR 157 156 6 159 5 1 1 29 48 -6.621 -0.054 -6.436 -6.648 -7.540 -0.544 -0.734 -1.204 1.188 + D 158 156 6 159 5 0 0 28 47 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 159 159 3 159 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 40 ] 39 52 G C - - + MP 160 159 3 164 6 2 2 28 47 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 161 159 3 164 6 1 1 27 46 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 162 159 3 164 6 1 1 27 46 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 163 159 3 164 6 0 0 25 44 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 164 164 5 164 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 165 165 6 165 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 41 ] 40 51 C G - - + MP 166 165 6 170 6 2 2 26 45 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 167 165 6 170 6 1 1 25 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 168 165 6 170 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 169 165 6 170 6 0 0 23 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 170 170 5 170 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 171 171 6 171 5 1 1 26 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 42 ] 41 50 c g - - + MP 172 171 6 176 6 2 2 24 43 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 173 171 6 176 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 174 171 6 176 6 1 1 23 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 175 171 6 176 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 176 176 5 176 6 1 1 24 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 177 177 6 177 5 1 1 24 43 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 43 ] 42 49 C G - - + MP 178 177 6 182 4 2 2 22 41 -6.338 -6.545 -0.082 -4.959 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 179 177 6 182 4 1 1 23 42 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 180 177 6 182 4 1 1 22 41 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 181 177 6 182 4 0 0 21 40 -4.568 -4.250 -2.265 -0.520 + IL 182 182 5 182 4 1 1 24 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 183 183 6 183 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 44 ] 43 - C - - - + ML 184 183 6 186 3 1 1 19 38 -7.407 -0.030 -6.061 -0.541 1.031 -1.289 -0.216 + D 185 183 6 186 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 186 186 3 186 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 45 ] 44 - U - - - + ML 187 186 3 189 3 1 1 18 37 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 188 186 3 189 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 189 189 3 189 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 46 ] 45 - U - - - + ML 190 189 3 192 3 1 1 17 35 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 191 189 3 192 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 192 192 3 192 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 47 ] 46 - U - - - + ML 193 192 3 195 3 1 1 15 34 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 194 192 3 195 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 195 195 3 195 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 48 ] 47 - U - - - + ML 196 195 3 198 3 1 1 13 32 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 197 195 3 198 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 198 198 3 198 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 49 ] 48 - C - - - + ML 199 198 3 201 2 1 1 1 1 * 0.000 -0.541 1.031 -1.289 -0.216 + D 200 198 3 201 2 0 0 0 0 * 0.000 + IL 201 201 3 201 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 50 ] - - - - - - + E 202 201 3 -1 0 0 0 0 0 + [ BEGR 51 ] - - - - - - + S 203 3 1 204 3 0 23 95 115 -7.407 -0.030 -6.061 + IL 204 204 2 204 3 1 24 98 118 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 52 ] 65 - U - - - + ML 205 204 2 207 3 1 23 95 115 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 206 204 2 207 3 0 19 93 114 -6.174 -1.687 -0.566 + IL 207 207 3 207 3 1 23 96 117 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 53 ] 66 - U - - - + ML 208 207 3 210 3 1 22 94 114 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 209 207 3 210 3 0 18 92 112 -6.174 -1.687 -0.566 + IL 210 210 3 210 3 1 22 95 116 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 54 ] 67 - U - - - + ML 211 210 3 213 3 1 21 93 113 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 212 210 3 213 3 0 18 91 111 -6.174 -1.687 -0.566 + IL 213 213 3 213 3 1 21 94 115 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 55 ] 68 - A - - - + ML 214 213 3 216 3 1 20 92 112 -7.407 -0.030 -6.061 1.335 -1.308 -1.041 -0.769 + D 215 213 3 216 3 0 17 90 110 -6.174 -1.687 -0.566 + IL 216 216 3 216 3 1 20 93 114 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 56 ] 69 - U - - - + ML 217 216 3 219 3 1 19 91 111 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 218 216 3 219 3 0 16 89 109 -6.174 -1.687 -0.566 + IL 219 219 3 219 3 1 20 92 113 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 57 ] 70 - U - - - + ML 220 219 3 222 3 1 19 89 109 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 221 219 3 222 3 0 15 88 108 -6.174 -1.687 -0.566 + IL 222 222 3 222 3 1 19 91 112 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 58 ] 71 - U - - - + ML 223 222 3 225 3 1 18 88 108 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 224 222 3 225 3 0 15 87 107 -6.174 -1.687 -0.566 + IL 225 225 3 225 3 1 18 90 110 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 59 ] 72 - U - - - + ML 226 225 3 228 3 1 17 87 107 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 227 225 3 228 3 0 14 86 106 -6.174 -1.687 -0.566 + IL 228 228 3 228 3 1 17 89 109 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 60 ] 73 - U - - - + ML 229 228 3 231 3 1 16 86 106 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 230 228 3 231 3 0 14 85 105 -6.174 -1.687 -0.566 + IL 231 231 3 231 3 1 16 88 108 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 61 ] 74 - G - - - + ML 232 231 3 234 3 1 15 85 105 -7.407 -0.030 -6.061 -0.445 -1.442 1.225 -0.838 + D 233 231 3 234 3 0 13 84 104 -6.174 -1.687 -0.566 + IL 234 234 3 234 3 1 15 87 107 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 62 ] 75 - C - - - + ML 235 234 3 237 2 1 14 84 104 -7.657 -0.007 -0.541 1.031 -1.289 -0.216 + D 236 234 3 237 2 0 13 83 103 -8.445 -0.004 + IL 237 237 3 237 2 1 14 85 105 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 63 ] - - - - - - + B 238 237 3 239 373 0 13 83 103 + [ BEGL 64 ] - - - - - - + S 239 238 1 240 4 0 0 59 79 -0.054 -6.557 -5.965 -6.605 + [ MATP 65 ] 76 119 g c - - + MP 240 239 1 244 6 2 3 59 79 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.036 -2.117 -3.144 1.409 -3.366 -4.171 0.907 -3.254 -2.999 2.129 -3.500 1.953 0.541 -3.463 -1.029 -1.997 + ML 241 239 1 244 6 1 1 58 77 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 242 239 1 244 6 1 1 58 77 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 243 239 1 244 6 0 0 55 75 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 244 244 5 244 6 1 1 59 78 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 245 245 6 245 5 1 1 59 78 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 66 ] 77 118 C G - - + MP 246 245 6 250 6 2 2 57 77 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 247 245 6 250 6 1 1 56 75 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 248 245 6 250 6 1 1 56 75 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 249 245 6 250 6 0 0 53 73 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 250 250 5 250 6 1 1 57 76 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 251 251 6 251 5 1 1 57 76 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 67 ] 78 117 u a - - + MP 252 251 6 256 6 2 2 55 75 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 253 251 6 256 6 1 1 54 73 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 254 251 6 256 6 1 1 54 73 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 255 251 6 256 6 0 0 51 71 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 256 256 5 256 6 1 1 55 74 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 257 257 6 257 5 1 1 55 74 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 68 ] 79 116 u a - - + MP 258 257 6 262 6 2 2 53 73 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 259 257 6 262 6 1 1 52 71 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 260 257 6 262 6 1 1 52 71 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 261 257 6 262 6 0 0 49 69 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 262 262 5 262 6 1 1 53 72 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 263 263 6 263 5 1 1 53 72 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 69 ] 80 115 c g - - + MP 264 263 6 268 6 2 2 51 71 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 265 263 6 268 6 1 1 50 69 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 266 263 6 268 6 1 1 50 69 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 267 263 6 268 6 0 0 47 67 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 268 268 5 268 6 1 1 51 70 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 269 269 6 269 5 1 1 51 70 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 70 ] 81 114 C G - - + MP 270 269 6 274 6 2 2 49 69 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 271 269 6 274 6 1 1 48 67 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 272 269 6 274 6 1 1 48 67 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 273 269 6 274 6 0 0 45 65 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 274 274 5 274 6 1 1 49 68 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 275 275 6 275 5 1 1 49 68 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 71 ] 82 113 C G - - + MP 276 275 6 280 6 2 2 47 67 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 277 275 6 280 6 1 1 46 65 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 278 275 6 280 6 1 1 46 65 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 279 275 6 280 6 0 0 44 63 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 280 280 5 280 6 1 1 47 66 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 281 281 6 281 5 1 1 47 66 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 72 ] 83 112 a u - - + MP 282 281 6 286 4 2 2 45 65 -6.315 -7.560 -0.120 -4.014 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 283 281 6 286 4 1 1 45 64 -2.408 -4.532 -1.293 -1.473 0.368 -0.385 -0.191 0.094 + MR 284 281 6 286 4 1 1 44 64 -4.102 -12.528 -0.390 -2.485 0.368 -0.385 -0.191 0.094 + D 285 281 6 286 4 0 0 42 62 -12.737 -14.007 -2.036 -0.404 + IL 286 286 5 286 4 1 1 45 64 -2.817 -4.319 -0.613 -2.698 0.000 0.000 0.000 0.000 + IR 287 287 6 287 3 1 1 45 64 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 73 ] - 111 - A - - + MR 288 287 6 290 5 1 1 43 63 -6.621 -0.054 -6.436 -6.648 -7.540 1.335 -1.308 -1.041 -0.769 + D 289 287 6 290 5 0 0 42 61 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 290 290 3 290 5 1 1 44 63 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 74 ] 84 110 a u - - + MP 291 290 3 295 6 2 2 42 62 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 292 290 3 295 6 1 1 41 61 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 293 290 3 295 6 1 1 41 61 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 294 290 3 295 6 0 0 39 59 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 295 295 5 295 6 1 1 42 61 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 296 296 6 296 5 1 1 42 61 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 75 ] 85 109 a u - - + MP 297 296 6 301 4 2 2 40 60 -6.338 -6.545 -0.082 -4.959 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 298 296 6 301 4 1 1 41 60 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 299 296 6 301 4 1 1 40 60 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 300 296 6 301 4 0 0 39 59 -4.568 -4.250 -2.265 -0.520 + IL 301 301 5 301 4 1 1 42 61 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 302 302 6 302 3 1 1 41 60 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 76 ] 86 - U - - - + ML 303 302 6 305 3 1 1 38 57 -7.842 -0.027 -6.159 -0.544 -0.734 -1.204 1.188 + D 304 302 6 305 3 0 0 36 55 -5.620 -0.734 -1.403 + IL 305 305 3 305 3 1 1 38 57 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 77 ] - 108 - U - - + MR 306 305 3 308 5 1 1 37 56 -6.621 -0.054 -6.436 -6.648 -7.540 -0.544 -0.734 -1.204 1.188 + D 307 305 3 308 5 0 0 35 54 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 308 308 3 308 5 1 1 37 56 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 78 ] 87 107 C G - - + MP 309 308 3 313 6 2 2 36 55 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 310 308 3 313 6 1 1 34 53 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 311 308 3 313 6 1 1 34 53 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 312 308 3 313 6 0 0 32 51 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 313 313 5 313 6 1 1 35 54 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 314 314 6 314 5 1 1 35 54 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 79 ] 88 106 a u - - + MP 315 314 6 319 6 2 2 34 53 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 316 314 6 319 6 1 1 32 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 317 314 6 319 6 1 1 32 51 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 318 314 6 319 6 0 0 30 49 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 319 319 5 319 6 1 1 33 52 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 320 320 6 320 5 1 1 33 52 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 80 ] 89 105 a u - - + MP 321 320 6 325 6 2 2 31 51 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 322 320 6 325 6 1 1 30 49 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 323 320 6 325 6 1 1 30 49 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 324 320 6 325 6 0 0 28 47 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 325 325 5 325 6 1 1 31 50 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 326 326 6 326 5 1 1 31 50 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 81 ] 90 104 u a - - + MP 327 326 6 331 6 2 2 29 49 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 328 326 6 331 6 1 1 28 47 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 329 326 6 331 6 1 1 28 47 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 330 326 6 331 6 0 0 26 45 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 331 331 5 331 6 1 1 29 48 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 332 332 6 332 5 1 1 29 48 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 82 ] 91 103 g c - - + MP 333 332 6 337 6 2 2 27 47 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.036 -2.117 -3.144 1.409 -3.366 -4.171 0.907 -3.254 -2.999 2.129 -3.500 1.953 0.541 -3.463 -1.029 -1.997 + ML 334 332 6 337 6 1 1 26 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 335 332 6 337 6 1 1 26 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 336 332 6 337 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 337 337 5 337 6 1 1 27 46 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 338 338 6 338 5 1 1 27 46 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 83 ] 92 102 u a - - + MP 339 338 6 343 6 2 2 25 45 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 340 338 6 343 6 1 1 25 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 341 338 6 343 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 342 338 6 343 6 0 0 23 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 343 343 5 343 6 1 1 25 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 344 344 6 344 5 1 1 25 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 84 ] 93 101 a u - - + MP 345 344 6 349 4 2 2 23 43 -6.338 -6.545 -0.082 -4.959 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 346 344 6 349 4 1 1 24 43 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 347 344 6 349 4 1 1 23 43 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 348 344 6 349 4 0 0 22 42 -4.568 -4.250 -2.265 -0.520 + IL 349 349 5 349 4 1 1 25 44 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 350 350 6 350 3 1 1 24 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 85 ] 94 - U - - - + ML 351 350 6 353 3 1 1 20 39 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 352 350 6 353 3 0 0 19 38 -6.174 -1.687 -0.566 + IL 353 353 3 353 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 86 ] 95 - A - - - + ML 354 353 3 356 3 1 1 19 38 -7.407 -0.030 -6.061 1.335 -1.308 -1.041 -0.769 + D 355 353 3 356 3 0 0 18 37 -6.174 -1.687 -0.566 + IL 356 356 3 356 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 87 ] 96 - U - - - + ML 357 356 3 359 3 1 1 18 37 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 358 356 3 359 3 0 0 17 36 -6.174 -1.687 -0.566 + IL 359 359 3 359 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 88 ] 97 - G - - - + ML 360 359 3 362 3 1 1 17 35 -7.407 -0.030 -6.061 -0.445 -1.442 1.225 -0.838 + D 361 359 3 362 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 362 362 3 362 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 89 ] 98 - U - - - + ML 363 362 3 365 3 1 1 15 34 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 364 362 3 365 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 365 365 3 365 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 90 ] 99 - G - - - + ML 366 365 3 368 3 1 1 13 32 -7.407 -0.030 -6.061 -0.445 -1.442 1.225 -0.838 + D 367 365 3 368 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 368 368 3 368 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 91 ] 100 - U - - - + ML 369 368 3 371 2 1 1 1 1 * 0.000 -0.544 -0.734 -1.204 1.188 + D 370 368 3 371 2 0 0 0 0 * 0.000 + IL 371 371 3 371 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 92 ] - - - - - - + E 372 371 3 -1 0 0 0 0 0 + [ BEGR 93 ] - - - - - - + S 373 238 1 374 3 0 0 37 56 -7.407 -0.030 -6.061 + IL 374 374 2 374 3 1 1 41 60 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 94 ] 120 - A - - - + ML 375 374 2 377 5 1 1 37 56 -6.621 -0.054 -6.436 -6.648 -7.540 1.335 -1.308 -1.041 -0.769 + D 376 374 2 377 5 0 0 36 55 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 377 377 3 377 5 1 1 38 56 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 95 ] 121 142 G C - - + MP 378 377 3 382 6 2 2 36 55 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 379 377 3 382 6 1 1 35 53 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 380 377 3 382 6 1 1 35 53 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 381 377 3 382 6 0 0 32 51 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 382 382 5 382 6 1 1 36 55 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 383 383 6 383 5 1 1 35 54 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 96 ] 122 141 G C - - + MP 384 383 6 388 6 2 2 34 53 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 385 383 6 388 6 1 1 33 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 386 383 6 388 6 1 1 33 51 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 387 383 6 388 6 0 0 30 49 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 388 388 5 388 6 1 1 34 53 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 389 389 6 389 5 1 1 33 52 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 97 ] 123 140 u a - - + MP 390 389 6 394 6 2 2 32 51 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.312 -3.051 -3.230 0.573 -2.394 -3.862 1.906 -3.011 -3.250 1.057 -3.656 -0.956 2.589 -3.479 -0.091 -2.142 + ML 391 389 6 394 6 1 1 31 49 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 392 389 6 394 6 1 1 31 49 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 393 389 6 394 6 0 0 28 47 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 394 394 5 394 6 1 1 32 51 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 395 395 6 395 5 1 1 31 50 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 98 ] 124 139 a u - - + MP 396 395 6 400 6 2 2 30 49 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 397 395 6 400 6 1 1 29 47 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 398 395 6 400 6 1 1 29 47 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 399 395 6 400 6 0 0 26 45 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 400 400 5 400 6 1 1 30 49 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 401 401 6 401 5 1 1 29 48 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 99 ] 125 138 a u - - + MP 402 401 6 406 6 2 2 28 47 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 403 401 6 406 6 1 1 27 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 404 401 6 406 6 1 1 27 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 405 401 6 406 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 406 406 5 406 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 407 407 6 407 5 1 1 27 46 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 100 ] 126 137 G C - - + MP 408 407 6 412 6 2 2 26 45 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.697 -2.609 -3.751 0.851 -3.760 -4.231 0.645 -3.874 -3.560 3.228 -3.981 -0.294 0.215 -3.763 -1.350 -2.643 + ML 409 407 6 412 6 1 1 25 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 410 407 6 412 6 1 1 25 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 411 407 6 412 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 412 412 5 412 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 413 413 6 413 5 1 1 25 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 101 ] 127 136 C G - - + MP 414 413 6 418 6 2 2 24 43 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.570 -3.342 -3.408 0.308 -2.396 -3.940 3.054 -3.092 -3.440 0.786 -3.788 -1.270 1.193 -3.691 -0.094 -2.319 + ML 415 413 6 418 6 1 1 23 42 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 416 413 6 418 6 1 1 23 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 417 413 6 418 6 0 0 21 39 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 418 418 5 418 6 1 1 24 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 419 419 6 419 5 1 1 23 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 102 ] 128 135 a u - - + MP 420 419 6 424 6 2 2 22 41 -8.904 -8.843 -0.024 -7.620 -7.899 -8.294 -3.112 -2.339 -3.161 2.510 -3.138 -4.180 1.137 -3.220 -3.090 1.868 -3.597 0.045 0.699 -3.491 -0.818 -2.045 + ML 421 419 6 424 6 1 1 21 40 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 422 419 6 424 6 1 1 21 40 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 423 419 6 424 6 0 0 20 38 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 424 424 5 424 6 1 1 22 41 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 425 425 6 425 5 1 1 22 40 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 103 ] 129 134 c g - - + MP 426 425 6 430 4 2 2 20 39 -6.338 -6.545 -0.082 -4.959 -3.170 -3.016 -3.070 0.555 -2.169 -3.651 2.087 -2.828 -3.105 0.958 -3.492 -1.029 1.407 -3.326 1.945 -2.022 + ML 427 425 6 430 4 1 1 21 40 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 428 425 6 430 4 1 1 20 39 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 429 425 6 430 4 0 0 19 38 -4.568 -4.250 -2.265 -0.520 + IL 430 430 5 430 4 1 1 22 41 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 431 431 6 431 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 104 ] 130 - U - - - + ML 432 431 6 434 3 1 1 17 35 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 433 431 6 434 3 0 0 16 35 -6.174 -1.687 -0.566 + IL 434 434 3 434 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 105 ] 131 - U - - - + ML 435 434 3 437 3 1 1 15 34 -7.407 -0.030 -6.061 -0.544 -0.734 -1.204 1.188 + D 436 434 3 437 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 437 437 3 437 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 106 ] 132 - C - - - + ML 438 437 3 440 3 1 1 13 32 -7.407 -0.030 -6.061 -0.541 1.031 -1.289 -0.216 + D 439 437 3 440 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 440 440 3 440 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 107 ] 133 - G - - - + ML 441 440 3 443 2 1 1 1 1 * 0.000 -0.445 -1.442 1.225 -0.838 + D 442 440 3 443 2 0 0 0 0 * 0.000 + IL 443 443 3 443 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 108 ] - - - - - - + E 444 443 3 -1 0 0 0 0 0 +// +HMMER3/f [3.4 | Aug 2023] +NAME SprD +ACC RF01828 +DESC Small pathogenicity island RNA D +LENG 142 +MAXL 260 +ALPH RNA +RF no +MM no +CONS yes +CS yes +MAP yes +DATE Wed Jul 10 07:50:53 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF01828/CM +NSEQ 2 +EFFN 1.027344 +CKSUM 1886193695 +STATS LOCAL MSV -10.2527 0.71825 +STATS LOCAL VITERBI -11.9474 0.71825 +STATS LOCAL FORWARD -3.2278 0.71825 +HMM A C G U + m->m m->i m->d i->m i->i d->m d->d + COMPO 1.55505 1.50433 1.38502 1.15095 + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 0.00000 * + 1 1.66413 2.17497 0.55611 2.09073 1 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 2 2.12782 2.43967 0.35192 2.40374 2 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 3 2.12702 2.43911 0.35225 2.40283 3 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 4 2.50104 0.50444 2.15704 1.61701 4 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 5 2.12601 2.43840 0.35265 2.40167 5 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 6 2.29355 1.28180 1.98038 0.72663 6 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 7 2.29078 1.43697 1.93103 0.66133 7 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 8 2.29291 1.28189 1.98021 0.72676 8 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 9 1.94417 2.03193 2.41979 0.45119 9 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 10 1.97980 0.51237 2.51695 1.70307 10 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 11 0.35741 2.50018 2.29733 2.13780 11 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 12 0.35741 2.50018 2.29733 2.13780 12 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 13 1.91289 2.65383 0.39412 2.22850 13 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 14 1.71574 2.14453 0.55420 2.05170 14 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 15 0.75910 2.09946 1.27269 2.04553 15 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 16 1.71586 2.14463 0.55411 2.05187 16 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 17 2.62734 0.40828 2.26502 1.83818 17 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 18 1.88649 2.31824 0.43856 2.25393 18 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 19 2.62565 0.40863 2.26448 1.83785 19 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 20 2.62259 0.40926 2.26350 1.83725 20 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 21 2.30606 1.33833 1.98417 0.69201 21 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 22 1.94417 2.03193 2.41979 0.45119 22 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 23 1.94417 2.03193 2.41979 0.45119 23 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 24 1.97980 0.51237 2.51695 1.70307 24 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 25 0.35741 2.50018 2.29733 2.13780 25 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 26 1.94417 2.03193 2.41979 0.45119 26 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 27 1.94417 2.03193 2.41979 0.45119 27 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 28 2.28904 1.43712 1.93063 0.66171 28 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 29 2.29051 1.43699 1.93097 0.66138 29 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 30 2.29099 1.43695 1.93108 0.66128 30 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 31 1.94417 2.03193 2.41979 0.45119 31 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 32 0.78616 2.01590 1.29869 1.97819 32 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 33 2.28917 1.43711 1.93065 0.66168 33 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 34 1.66255 2.17343 0.55750 2.08813 34 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 35 1.94417 2.03193 2.41979 0.45119 35 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 36 0.78615 2.01592 1.29868 1.97824 36 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 37 2.29165 1.28207 1.97987 0.72701 37 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 38 2.29054 1.43699 1.93097 0.66138 38 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 39 2.11245 2.42889 0.35818 2.38621 39 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 40 2.48794 0.50752 2.15304 1.61546 40 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 41 2.28864 1.28250 1.97906 0.72763 41 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 42 2.49560 0.50571 2.15538 1.61637 42 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 43 1.97980 0.51237 2.51695 1.70307 43 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 44 1.94417 2.03193 2.41979 0.45119 44 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 45 1.94417 2.03193 2.41979 0.45119 45 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 46 1.94417 2.03193 2.41979 0.45119 46 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 47 1.94417 2.03193 2.41979 0.45119 47 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 48 1.97980 0.51237 2.51695 1.70307 48 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 49 1.88604 2.31787 0.43882 2.25333 49 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 50 1.71546 2.14431 0.55442 2.05132 50 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 51 1.88593 2.31777 0.43889 2.25318 51 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 52 2.62443 0.40888 2.26409 1.83761 52 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 53 1.94417 2.03193 2.41979 0.45119 53 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 54 0.75883 2.09994 1.27251 2.04643 54 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 55 1.71664 2.14526 0.55350 2.05292 55 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 56 2.21623 1.51622 1.83669 0.66924 56 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 57 1.94417 2.03193 2.41979 0.45119 57 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 58 2.31503 1.33726 1.98654 0.69015 58 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 59 0.75877 2.10004 1.27247 2.04664 59 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 60 2.21619 1.51622 1.83668 0.66925 60 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 61 1.94417 2.03193 2.41979 0.45119 61 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 62 0.75928 2.09913 1.27282 2.04491 62 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 63 0.75954 2.09866 1.27300 2.04402 63 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 64 0.76008 2.09768 1.27338 2.04217 64 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 65 1.94417 2.03193 2.41979 0.45119 65 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 66 1.94417 2.03193 2.41979 0.45119 66 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 67 1.94417 2.03193 2.41979 0.45119 67 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 68 0.35741 2.50018 2.29733 2.13780 68 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 69 1.94417 2.03193 2.41979 0.45119 69 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 70 1.94417 2.03193 2.41979 0.45119 70 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 71 1.94417 2.03193 2.41979 0.45119 71 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 72 1.94417 2.03193 2.41979 0.45119 72 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 73 1.94417 2.03193 2.41979 0.45119 73 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 74 1.91289 2.65383 0.39412 2.22850 74 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 75 1.97980 0.51237 2.51695 1.70307 75 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 76 1.66413 2.17497 0.55611 2.09073 76 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 77 2.50341 0.50389 2.15776 1.61728 77 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 78 2.29287 1.43678 1.93152 0.66086 78 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 79 2.29213 1.43685 1.93135 0.66103 79 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 80 2.29399 1.28174 1.98049 0.72654 80 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 81 2.49970 0.50476 2.15663 1.61685 81 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 82 2.49923 0.50487 2.15649 1.61679 82 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 83 0.78554 2.01682 1.29827 1.98017 83 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 84 0.78788 2.01333 1.29985 1.97275 84 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 85 0.78672 2.01506 1.29906 1.97643 85 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 86 1.94417 2.03193 2.41979 0.45119 86 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 87 2.49218 0.50652 2.15433 1.61596 87 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 88 0.78575 2.01652 1.29841 1.97951 88 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 89 0.78556 2.01680 1.29828 1.98011 89 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 90 2.29082 1.43697 1.93104 0.66132 90 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 91 1.66266 2.17355 0.55740 2.08832 91 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 92 2.29072 1.43698 1.93102 0.66134 92 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 93 0.78554 2.01683 1.29827 1.98018 93 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 94 1.94417 2.03193 2.41979 0.45119 94 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 95 0.35741 2.50018 2.29733 2.13780 95 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 96 1.94417 2.03193 2.41979 0.45119 96 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 97 1.91289 2.65383 0.39412 2.22850 97 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 98 1.94417 2.03193 2.41979 0.45119 98 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 99 1.91289 2.65383 0.39412 2.22850 99 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 100 1.94417 2.03193 2.41979 0.45119 100 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 101 2.21401 1.51637 1.83626 0.66979 101 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 102 0.75903 2.09957 1.27265 2.04575 102 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 103 2.31402 1.33738 1.98627 0.69036 103 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 104 0.75891 2.09979 1.27256 2.04616 104 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 105 2.21546 1.51627 1.83654 0.66943 105 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 106 2.21584 1.51625 1.83661 0.66934 106 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 107 1.88777 2.31931 0.43781 2.25569 107 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 108 1.94417 2.03193 2.41979 0.45119 108 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 109 2.21263 1.51646 1.83600 0.67013 109 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 110 2.21211 1.51649 1.83590 0.67025 110 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 111 0.35741 2.50018 2.29733 2.13780 111 A - - - + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 112 2.21374 1.51639 1.83621 0.66985 112 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 113 1.88652 2.31827 0.43854 2.25398 113 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 114 1.88660 2.31833 0.43849 2.25409 114 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 115 1.71587 2.14464 0.55410 2.05188 115 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 116 0.75911 2.09944 1.27270 2.04550 116 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 117 0.75922 2.09923 1.27278 2.04510 117 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 118 1.88506 2.31705 0.43939 2.25199 118 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 119 2.30606 1.33833 1.98417 0.69201 119 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 120 0.35741 2.50018 2.29733 2.13780 120 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 121 2.12609 2.43846 0.35262 2.40177 121 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 122 2.12669 2.43888 0.35238 2.40245 122 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 123 2.29246 1.43682 1.93142 0.66095 123 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 124 0.78532 2.01716 1.29812 1.98088 124 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 125 0.78537 2.01708 1.29815 1.98072 125 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 126 2.12587 2.43830 0.35271 2.40151 126 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 127 2.49957 0.50479 2.15660 1.61683 127 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 128 0.78551 2.01687 1.29825 1.98027 128 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 129 2.29288 1.28190 1.98020 0.72676 129 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 130 1.94417 2.03193 2.41979 0.45119 130 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 131 1.94417 2.03193 2.41979 0.45119 131 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 132 1.97980 0.51237 2.51695 1.70307 132 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 133 1.91289 2.65383 0.39412 2.22850 133 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 134 1.71578 2.14457 0.55417 2.05175 134 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 135 2.21411 1.51636 1.83628 0.66976 135 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 136 1.88682 2.31852 0.43837 2.25439 136 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 137 2.62860 0.40802 2.26543 1.83842 137 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 138 2.21517 1.51629 1.83648 0.66950 138 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 139 2.21554 1.51627 1.83656 0.66941 139 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 140 0.75879 2.10001 1.27248 2.04658 140 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 141 2.63054 0.40762 2.26605 1.83880 141 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06093 3.52152 3.52152 1.46634 0.26236 1.09861 0.40547 + 142 2.62966 0.40780 2.26577 1.83863 142 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03093 3.49152 * 1.46634 0.26236 0.00000 * +// +INFERNAL1/a [1.1.5 | Sep 2023] +NAME rli28 +ACC RF01492 +DESC Listeria sRNA rli28 +STATES 572 +NODES 168 +CLEN 186 +W 220 +ALPH RNA +RF no +CONS yes +MAP yes +DATE Sun Jul 7 10:11:55 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF01492/CM +PBEGIN 0.05 +PEND 0.05 +WBETA 1e-07 +QDBBETA1 1e-07 +QDBBETA2 1e-15 +N2OMEGA 1.52588e-05 +N3OMEGA 1.52588e-05 +ELSELF -0.08926734 +NSEQ 21 +EFFN 6.698364 +CKSUM 3682069606 +NULL 0.000 0.000 0.000 0.000 +GA 45.00 +TC 45.00 +NC 44.80 +EFP7GF -8.1233 0.71365 +ECMLC 0.58361 -10.24387 0.22350 1600000 539798 0.002223 +ECMGC 0.29315 -26.96661 -16.06966 1600000 9759 0.040988 +ECMLI 0.38659 -13.49855 1.91678 1600000 464879 0.002581 +ECMGI 0.32011 -17.00692 -6.97888 1600000 9912 0.040355 +CM + [ ROOT 0 ] - - - - - - + S 0 -1 0 1 4 1 1 220 257 -8.183 -8.390 -0.022 -6.804 + IL 1 1 2 1 4 86 130 223 260 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 2 2 3 2 3 85 129 222 259 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 1 ] 1 - u - - - + ML 3 2 3 5 3 86 129 220 257 -9.139 -0.009 -7.793 0.018 -0.760 0.006 0.477 + D 4 2 3 5 3 80 124 218 255 -6.174 -1.687 -0.566 + IL 5 5 3 5 3 85 128 221 258 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 2 ] 2 - U - - - + ML 6 5 3 8 3 85 128 219 256 -9.139 -0.009 -7.793 -0.073 -1.402 -0.651 1.024 + D 7 5 3 8 3 79 123 217 254 -6.174 -1.687 -0.566 + IL 8 8 3 8 3 84 127 220 257 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 3 ] 3 - a - - - + ML 9 8 3 11 3 84 127 218 255 -9.139 -0.009 -7.793 0.589 -0.693 -0.942 0.440 + D 10 8 3 11 3 78 122 216 253 -6.174 -1.687 -0.566 + IL 11 11 3 11 3 83 126 219 256 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 4 ] 4 - a - - - + ML 12 11 3 14 3 83 126 217 254 -9.139 -0.009 -7.793 0.472 -0.312 -1.064 0.410 + D 13 11 3 14 3 78 121 215 252 -6.174 -1.687 -0.566 + IL 14 14 3 14 3 82 126 218 255 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 5 ] 5 - u - - - + ML 15 14 3 17 3 82 125 216 253 -9.139 -0.009 -7.793 -0.290 -0.261 -0.403 0.670 + D 16 14 3 17 3 77 120 214 251 -6.174 -1.687 -0.566 + IL 17 17 3 17 3 81 125 217 254 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 6 ] 6 - u - - - + ML 18 17 3 20 3 82 124 215 252 -9.139 -0.009 -7.793 0.234 -0.935 -1.704 0.996 + D 19 17 3 20 3 76 119 213 250 -6.174 -1.687 -0.566 + IL 20 20 3 20 3 81 124 216 253 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 7 ] 7 - A - - - + ML 21 20 3 23 3 81 123 214 251 -9.139 -0.009 -7.793 1.533 -2.147 -1.398 -0.998 + D 22 20 3 23 3 75 119 212 249 -6.174 -1.687 -0.566 + IL 23 23 3 23 3 80 123 215 252 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 8 ] 8 - U - - - + ML 24 23 3 26 3 80 122 213 250 -9.139 -0.009 -7.793 -3.610 -3.290 -4.399 1.914 + D 25 23 3 26 3 75 118 211 248 -6.174 -1.687 -0.566 + IL 26 26 3 26 3 79 122 214 251 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 9 ] 9 - G - - - + ML 27 26 3 29 3 79 121 212 249 -9.139 -0.009 -7.793 -2.793 -3.926 1.845 -2.347 + D 28 26 3 29 3 74 117 210 247 -6.174 -1.687 -0.566 + IL 29 29 3 29 3 78 121 213 250 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 10 ] 10 - u - - - + ML 30 29 3 32 3 78 120 211 248 -9.139 -0.009 -7.793 -0.018 0.104 -0.472 0.283 + D 31 29 3 32 3 73 116 209 246 -6.174 -1.687 -0.566 + IL 32 32 3 32 3 77 120 212 249 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 11 ] 11 - U - - - + ML 33 32 3 35 3 77 119 210 247 -9.139 -0.009 -7.793 -2.288 -2.259 -2.053 1.742 + D 34 32 3 35 3 72 115 208 245 -6.174 -1.687 -0.566 + IL 35 35 3 35 3 76 119 211 248 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 12 ] 12 - A - - - + ML 36 35 3 38 3 76 118 209 246 -9.139 -0.009 -7.793 1.666 -2.487 -1.670 -1.583 + D 37 35 3 38 3 72 114 207 244 -6.174 -1.687 -0.566 + IL 38 38 3 38 3 76 118 210 247 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 13 ] 13 - U - - - + ML 39 38 3 41 3 75 117 208 245 -9.139 -0.009 -7.793 -1.150 -1.018 -2.516 1.527 + D 40 38 3 41 3 71 114 206 243 -6.174 -1.687 -0.566 + IL 41 41 3 41 3 75 117 209 246 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 14 ] 14 - A - - - + ML 42 41 3 44 3 74 116 207 244 -9.139 -0.009 -7.793 1.773 -2.890 -2.911 -1.673 + D 43 41 3 44 3 70 113 205 242 -6.174 -1.687 -0.566 + IL 44 44 3 44 3 74 116 208 245 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 15 ] 15 - A - - - + ML 45 44 3 47 3 73 115 206 243 -1.205 -1.052 -3.574 1.547 -1.573 -2.258 -0.907 + D 46 44 3 47 3 70 112 202 239 -6.174 -1.687 -0.566 + IL 47 47 3 47 3 74 116 207 244 -0.824 -1.229 -6.877 0.000 0.000 0.000 0.000 + [ MATL 16 ] 19 - U - - - + ML 48 47 3 50 3 72 114 202 239 -9.020 -0.010 -7.674 -1.351 -1.264 -1.913 1.549 + D 49 47 3 50 3 69 112 201 238 -7.585 -0.433 -1.977 + IL 50 50 3 50 3 72 114 203 240 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 17 ] 20 - a - - - + ML 51 50 3 53 3 71 113 201 238 -9.139 -0.009 -7.793 0.703 -0.989 -0.655 0.302 + D 52 50 3 53 3 67 109 199 236 -6.174 -1.687 -0.566 + IL 53 53 3 53 3 71 113 202 239 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 18 ] 21 - A - - - + ML 54 53 3 56 3 70 112 200 237 -9.139 -0.009 -7.793 1.117 -0.757 -0.837 -0.558 + D 55 53 3 56 3 66 109 198 235 -6.174 -1.687 -0.566 + IL 56 56 3 56 3 70 112 201 238 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 19 ] 22 - a - - - + ML 57 56 3 59 3 69 111 199 236 -9.139 -0.009 -7.793 0.858 -0.726 -1.086 0.153 + D 58 56 3 59 3 66 108 197 234 -6.174 -1.687 -0.566 + IL 59 59 3 59 3 69 111 200 237 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 20 ] 23 - a - - - + ML 60 59 3 62 3 68 110 198 235 -9.139 -0.009 -7.793 0.457 -0.722 -0.365 0.316 + D 61 59 3 62 3 65 107 196 233 -6.174 -1.687 -0.566 + IL 62 62 3 62 3 68 110 199 236 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 21 ] 24 - g - - - + ML 63 62 3 65 3 67 109 197 234 -9.139 -0.284 -2.497 0.045 -0.802 0.590 -0.169 + D 64 62 3 65 3 65 107 195 232 -6.174 -1.687 -0.566 + IL 65 65 3 65 3 68 110 199 235 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 22 ] 25 - u - - - + ML 66 65 3 68 3 68 110 197 233 -8.866 -0.011 -7.520 0.096 -0.154 -1.005 0.618 + D 67 65 3 68 3 64 106 194 230 -8.377 -3.890 -0.105 + IL 68 68 3 68 3 68 110 198 234 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 23 ] 26 - a - - - + ML 69 68 3 71 3 67 109 196 232 -8.866 -0.150 -3.367 0.654 -0.853 -0.251 0.046 + D 70 68 3 71 3 64 106 193 230 -8.377 -3.890 -0.105 + IL 71 71 3 71 3 67 109 197 233 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 24 ] 27 - G - - - + ML 72 71 3 74 3 66 108 195 231 -8.727 -0.012 -7.381 -0.819 -2.098 1.419 -0.929 + D 73 71 3 74 3 64 106 193 230 -8.802 -2.411 -0.304 + IL 74 74 3 74 3 67 108 196 232 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 25 ] 28 - u - - - + ML 75 74 3 77 3 66 107 194 230 -8.804 -0.011 -7.458 -0.928 0.024 -1.029 0.977 + D 76 74 3 77 3 63 105 193 229 -8.589 -0.200 -2.980 + IL 77 77 3 77 3 65 107 195 231 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 26 ] 29 - A - - - + ML 78 77 3 80 3 65 106 193 229 -9.139 -0.009 -7.793 1.943 -4.574 -4.039 -4.293 + D 79 77 3 80 3 61 103 191 227 -6.174 -1.687 -0.566 + IL 80 80 3 80 3 64 106 194 230 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 27 ] 30 - G - - - + ML 81 80 3 83 3 64 105 192 228 -9.139 -0.009 -7.793 -0.796 -3.374 1.674 -2.877 + D 82 80 3 83 3 60 102 190 226 -6.174 -1.687 -0.566 + IL 83 83 3 83 3 63 105 193 229 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 28 ] 31 - c - - - + ML 84 83 3 86 3 63 104 191 227 -9.139 -0.009 -7.793 0.038 0.408 -0.625 -0.003 + D 85 83 3 86 3 60 101 189 225 -6.174 -1.687 -0.566 + IL 86 86 3 86 3 63 104 192 228 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 29 ] 32 - A - - - + ML 87 86 3 89 3 62 103 190 226 -9.139 -0.009 -7.793 1.734 -1.567 -2.732 -2.426 + D 88 86 3 89 3 59 101 188 224 -6.174 -1.687 -0.566 + IL 89 89 3 89 3 62 103 191 227 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 30 ] 33 - A - - - + ML 90 89 3 92 3 61 102 189 225 -9.139 -0.195 -3.002 1.943 -4.574 -4.039 -4.293 + D 91 89 3 92 3 58 100 187 224 -6.174 -1.687 -0.566 + IL 92 92 3 92 3 61 103 190 226 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 31 ] 34 - A - - - + ML 93 92 3 95 3 60 102 188 225 -8.954 -0.010 -7.608 1.249 -1.916 -0.206 -1.027 + D 94 92 3 95 3 58 99 186 223 -7.986 -0.892 -1.129 + IL 95 95 3 95 3 60 102 189 225 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 32 ] 35 - G - - - + ML 96 95 3 98 3 59 101 187 224 -9.073 -0.010 -7.727 -1.781 -2.671 1.541 -0.639 + D 97 95 3 98 3 57 99 185 222 -7.123 -2.636 -0.265 + IL 98 98 3 98 3 59 101 188 224 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 33 ] 36 - U - - - + ML 99 98 3 101 3 58 100 186 223 -9.073 -0.528 -1.715 -3.505 -3.196 -4.293 1.908 + D 100 98 3 101 3 57 98 185 221 -7.123 -0.638 -1.515 + IL 101 101 3 101 3 59 101 187 224 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 34 ] 37 - G - - - + ML 102 101 3 104 3 58 100 185 222 -8.652 -0.013 -7.306 -1.226 -2.049 1.374 -0.436 + D 103 101 3 104 3 56 97 183 220 -8.977 -2.631 -0.258 + IL 104 104 3 104 3 58 100 186 223 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 35 ] 38 - a - - - + ML 105 104 3 107 3 57 99 184 221 -8.729 -0.012 -7.383 0.482 -1.162 -0.031 0.237 + D 106 104 3 107 3 56 97 183 220 -8.798 -0.426 -1.979 + IL 107 107 3 107 3 57 99 185 222 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 36 ] 39 - a - - - + ML 108 107 3 110 3 56 98 183 220 -9.076 -0.009 -7.730 0.873 -1.410 -0.469 0.098 + D 109 107 3 110 3 54 96 182 218 -7.090 -0.656 -1.482 + IL 110 110 3 110 3 56 98 184 221 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 37 ] 40 - u - - - + ML 111 110 3 113 3 55 97 182 219 -9.139 -0.009 -7.793 0.629 -1.617 -1.841 0.886 + D 112 110 3 113 3 53 95 181 217 -6.174 -1.687 -0.566 + IL 113 113 3 113 3 56 97 183 220 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 38 ] 41 - A - - - + ML 114 113 3 116 3 54 96 181 218 -9.139 -0.652 -1.466 1.848 -3.322 -3.237 -2.361 + D 115 113 3 116 3 53 94 180 217 -6.174 -1.687 -0.566 + IL 116 116 3 116 3 55 96 183 219 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 39 ] 42 - u - - - + ML 117 116 3 119 3 54 95 181 217 -8.501 -0.014 -7.155 0.493 -1.135 -1.379 0.810 + D 118 116 3 119 3 52 94 180 216 -9.255 -0.123 -3.647 + IL 119 119 3 119 3 54 95 182 218 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 40 ] 43 - G - - - + ML 120 119 3 122 3 53 94 180 216 -9.139 -0.009 -7.793 -1.974 -4.134 1.850 -3.576 + D 121 119 3 122 3 50 91 178 214 -6.174 -1.687 -0.566 + IL 122 122 3 122 3 53 94 181 217 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 41 ] 44 - A - - - + ML 123 122 3 125 3 52 93 179 215 -9.139 -0.009 -7.793 1.502 -1.691 -0.766 -1.888 + D 124 122 3 125 3 49 90 177 213 -6.174 -1.687 -0.566 + IL 125 125 3 125 3 52 93 180 216 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 42 ] 45 - U - - - + ML 126 125 3 128 3 51 92 178 214 -9.139 -0.009 -7.793 -1.363 0.330 -1.637 1.023 + D 127 125 3 128 3 49 90 176 212 -6.174 -1.687 -0.566 + IL 128 128 3 128 3 51 92 179 215 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 43 ] 46 - G - - - + ML 129 128 3 131 3 50 91 177 213 -9.476 -0.061 -4.642 -1.497 -3.067 1.708 -1.949 + D 130 128 3 131 3 48 89 175 212 -5.620 -0.734 -1.403 + IL 131 131 3 131 3 50 91 177 214 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 44 ] - 221 - A - - + MR 132 131 3 134 3 49 90 176 212 -9.424 -0.009 -7.741 1.221 -1.644 -1.137 -0.161 + D 133 131 3 134 3 47 88 174 211 -7.108 -0.744 -1.337 + IR 134 134 3 134 3 49 90 176 213 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 45 ] - 220 - A - - + MR 135 134 3 137 3 48 89 175 211 -9.476 -0.009 -7.794 1.461 -1.243 -0.957 -1.688 + D 136 134 3 137 3 46 87 173 209 -6.390 -1.568 -0.620 + IR 137 137 3 137 3 48 89 175 212 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 46 ] - 219 - u - - + MR 138 137 3 140 3 47 88 174 210 -9.476 -0.009 -7.794 -0.200 0.011 -0.851 0.648 + D 139 137 3 140 3 45 86 172 208 -6.390 -1.568 -0.620 + IR 140 140 3 140 3 47 89 174 211 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 47 ] - 218 - u - - + MR 141 140 3 143 3 46 87 173 209 -9.476 -0.009 -7.794 0.424 -0.985 -0.807 0.661 + D 142 140 3 143 3 45 86 171 208 -6.390 -1.568 -0.620 + IR 143 143 3 143 3 47 88 173 210 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 48 ] - 217 - u - - + MR 144 143 3 146 2 45 86 172 208 -9.684 -0.002 0.330 -0.059 -1.008 0.363 + D 145 143 3 146 2 44 85 171 207 -4.432 -0.068 + IR 146 146 3 146 2 46 87 172 209 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 49 ] - - - - - - + B 147 146 3 217 148 44 85 171 207 + [ BEGR 150 ] - - - - - - + S 148 147 1 149 3 0 0 45 75 -9.139 -0.009 -7.793 + IL 149 149 2 149 3 1 1 47 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 151 ] 191 - u - - - + ML 150 149 2 152 3 1 1 45 75 -9.139 -0.009 -7.793 -0.112 -0.200 -0.367 0.515 + D 151 149 2 152 3 0 0 43 73 -6.174 -1.687 -0.566 + IL 152 152 3 152 3 1 1 46 76 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 152 ] 192 - U - - - + ML 153 152 3 155 3 1 1 44 74 -9.139 -0.009 -7.793 -1.146 0.184 -2.296 1.143 + D 154 152 3 155 3 0 0 43 72 -6.174 -1.687 -0.566 + IL 155 155 3 155 3 1 1 45 75 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 153 ] 193 - U - - - + ML 156 155 3 158 3 1 1 43 73 -9.139 -0.009 -7.793 -1.400 -2.268 -3.017 1.718 + D 157 155 3 158 3 0 0 42 72 -6.174 -1.687 -0.566 + IL 158 158 3 158 3 1 1 44 74 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 154 ] 194 - u - - - + ML 159 158 3 161 5 1 1 42 72 -8.162 -0.018 -7.977 -8.190 -9.081 0.358 -0.603 -0.621 0.495 + D 160 158 3 161 5 0 0 41 71 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 161 161 3 161 5 1 1 43 72 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 155 ] 195 216 g c - - + MP 162 161 3 166 6 2 2 41 71 -9.708 -9.648 -0.047 -5.303 -8.704 -9.099 -4.068 -2.823 -3.948 2.065 -4.847 -4.619 -0.106 -4.522 -4.268 2.907 -4.583 0.211 0.391 -3.874 -2.093 -2.902 + ML 163 161 3 166 6 1 1 40 70 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 164 161 3 166 6 1 1 39 69 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 165 161 3 166 6 0 0 37 67 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 166 166 5 166 6 1 1 41 71 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 167 167 6 167 5 1 1 41 71 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 156 ] 196 215 u a - - + MP 168 167 6 172 6 2 2 39 69 -9.676 -9.615 -0.122 -8.392 -3.764 -9.066 -3.311 -3.317 -3.414 0.289 -1.041 -4.234 1.806 -3.349 -3.399 0.407 -3.931 -0.096 2.703 -3.580 0.187 -2.367 + ML 169 167 6 172 6 1 1 38 68 -6.788 -7.134 -0.764 -1.543 -6.984 -4.514 -0.159 -0.482 -0.776 0.852 + MR 170 167 6 172 6 1 1 38 67 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 171 167 6 172 6 0 0 35 65 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 172 172 5 172 6 1 1 39 69 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 173 173 6 173 5 1 1 39 69 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 157 ] 197 214 c g - - + MP 174 173 6 178 6 2 2 37 67 -4.540 -9.544 -0.077 -8.320 -8.600 -8.995 -0.431 -1.997 -0.795 0.916 -0.484 -2.838 1.871 -2.318 -2.050 0.753 -2.622 -0.241 1.421 -2.128 0.649 -1.242 + ML 175 173 6 178 6 1 1 36 66 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 176 173 6 178 6 1 1 35 65 -8.138 -6.867 -2.775 -6.845 -0.316 -5.058 1.462 -1.557 -1.269 -1.031 + D 177 173 6 178 6 0 0 34 64 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 178 178 5 178 6 1 1 37 67 -3.237 -3.500 -0.434 -5.155 -5.931 -5.592 0.000 0.000 0.000 0.000 + IR 179 179 6 179 5 1 1 37 67 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 158 ] 199 213 u a - - + MP 180 179 6 184 4 2 2 35 65 -8.003 -8.210 -0.025 -6.624 -1.767 -0.994 -1.964 1.402 -1.954 -2.803 1.212 -2.309 -0.536 1.248 -1.285 -0.122 1.702 -2.099 0.107 -1.225 + ML 181 179 6 184 4 1 1 35 65 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 182 179 6 184 4 1 1 34 64 -6.075 -5.104 -1.640 -0.655 0.317 -0.685 -0.109 0.270 + D 183 179 6 184 4 0 0 33 63 -4.568 -4.250 -2.265 -0.520 + IL 184 184 5 184 4 1 1 36 66 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 185 185 6 185 3 1 1 35 65 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 159 ] 200 - U - - - + ML 186 185 6 188 3 1 1 33 63 -9.365 -0.088 -4.114 -3.426 -3.127 -4.213 1.902 + D 187 185 6 188 3 0 0 32 62 -6.596 -0.877 -1.168 + IL 188 188 3 188 3 1 1 34 64 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 160 ] - 212 - U - - + MR 189 188 3 191 5 1 1 32 62 -8.035 -0.020 -7.851 -8.063 -8.954 0.144 -1.352 -1.124 1.032 + D 190 188 3 191 5 0 0 31 61 -6.265 -0.332 -3.891 -5.322 -3.317 + IR 191 191 3 191 5 1 1 33 63 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 161 ] 201 211 g c - - + MP 192 191 3 196 6 2 2 31 61 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -0.492 -0.201 -1.970 0.901 -1.017 -2.813 1.323 -2.320 -1.107 1.612 -2.602 0.051 1.328 -1.156 -0.230 -1.238 + ML 193 191 3 196 6 1 1 30 60 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 194 191 3 196 6 1 1 30 60 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 195 191 3 196 6 0 0 27 57 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 196 196 5 196 6 1 1 31 61 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 197 197 6 197 5 1 1 31 61 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 162 ] 202 210 a u - - + MP 198 197 6 202 4 2 2 29 59 -8.183 -2.857 -0.235 -6.804 -1.750 -0.557 -1.075 1.684 -0.565 -2.800 1.413 -2.300 -1.080 1.099 -1.385 -0.660 1.191 -1.176 -0.212 -1.220 + ML 199 197 6 202 4 1 1 28 58 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 200 197 6 202 4 1 1 28 58 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 201 197 6 202 4 0 0 27 57 -4.568 -4.250 -2.265 -0.520 + IL 202 202 5 202 4 1 1 30 60 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 203 203 6 203 3 1 1 31 61 -0.889 -1.184 -5.660 0.000 0.000 0.000 0.000 + [ MATL 163 ] 203 - U - - - + ML 204 203 6 206 3 1 1 15 34 -9.139 -0.009 -7.793 -0.741 -0.193 -2.108 1.199 + D 205 203 6 206 3 0 0 16 34 -6.174 -1.687 -0.566 + IL 206 206 3 206 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 164 ] 204 - g - - - + ML 207 206 3 209 3 1 1 14 32 -9.139 -0.009 -7.793 -0.206 -0.842 0.517 0.194 + D 208 206 3 209 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 209 209 3 209 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 165 ] 205 - a - - - + ML 210 209 3 212 3 1 1 12 31 -9.139 -0.009 -7.793 0.913 -0.754 -0.670 -0.160 + D 211 209 3 212 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 212 212 3 212 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 166 ] 206 - U - - - + ML 213 212 3 215 2 1 1 1 1 * 0.000 -1.070 -1.182 0.036 1.041 + D 214 212 3 215 2 0 0 0 0 * 0.000 + IL 215 215 3 215 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 167 ] - - - - - - + E 216 215 3 -1 0 0 0 0 0 + [ BEGL 50 ] - - - - - - + S 217 147 1 218 4 25 65 148 184 -0.026 -7.585 -6.993 -7.633 + [ MATP 51 ] 47 190 g c - - + MP 218 217 1 222 6 27 66 148 184 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -2.723 -1.049 -2.858 0.871 -3.078 -3.548 0.558 -3.258 -1.097 2.628 0.291 0.405 0.364 -2.888 -0.416 -2.007 + ML 219 217 1 222 6 21 60 146 182 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 220 217 1 222 6 21 59 146 182 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 221 217 1 222 6 16 54 143 179 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 222 222 5 222 6 22 62 147 184 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 223 223 6 223 5 23 62 147 183 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 52 ] 48 189 u a - - + MP 224 223 6 228 6 26 64 146 182 -9.708 -9.648 -0.048 -5.269 -8.704 -9.099 -2.988 -3.120 -3.112 0.131 -0.938 -3.903 1.185 -3.211 -3.149 0.124 -3.679 -1.517 2.830 -0.479 0.930 -2.230 + ML 225 223 6 228 6 21 60 144 181 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 226 223 6 228 6 20 58 144 180 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 227 223 6 228 6 16 54 141 177 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 228 228 5 228 6 22 61 145 182 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 229 229 6 229 5 22 61 145 181 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 53 ] 49 188 g u - - + MP 230 229 6 234 6 25 63 144 180 -9.675 -9.614 -0.014 -8.391 -8.670 -9.065 -2.585 -0.627 -4.023 0.752 -4.312 -2.603 0.170 -3.225 1.084 1.181 0.113 2.398 -0.666 -3.107 -1.806 -2.168 + ML 231 229 6 234 6 21 59 142 179 -6.800 -7.146 -0.755 -1.555 -6.996 -4.526 -0.033 -0.932 0.786 -0.369 + MR 232 229 6 234 6 19 57 142 178 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 233 229 6 234 6 16 53 139 176 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 234 234 5 234 6 21 60 143 180 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 235 235 6 235 5 21 60 143 179 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 54 ] 50 187 g c - - + MP 236 235 6 240 6 24 61 142 178 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -4.676 -3.319 -4.730 0.198 -5.830 -5.549 -1.207 -5.065 -4.589 2.877 1.445 1.792 -1.432 -4.874 -3.156 -3.558 + ML 237 235 6 240 6 19 57 140 177 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 238 235 6 240 6 18 56 140 176 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 239 235 6 240 6 15 53 138 174 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 240 240 5 240 6 21 59 141 178 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 241 241 6 241 5 20 58 141 177 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 55 ] 51 186 C G - - + MP 242 241 6 246 4 22 59 140 176 -8.183 -8.390 -0.022 -6.804 -5.527 -5.636 -5.082 -1.806 1.602 -5.380 3.328 -4.459 -5.136 -1.700 -5.363 -3.741 -0.155 -5.499 0.099 -3.951 + ML 243 241 6 246 4 18 56 139 176 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 244 241 6 246 4 16 54 138 175 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 245 241 6 246 4 15 53 137 174 -4.568 -4.250 -2.265 -0.520 + IL 246 246 5 246 4 20 58 140 177 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 247 247 6 247 3 20 57 140 176 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 56 ] 52 - U - - - + ML 248 247 6 250 3 21 57 138 174 -9.139 -0.009 -7.793 -1.002 -1.229 -1.185 1.397 + D 249 247 6 250 3 15 52 136 172 -6.174 -1.687 -0.566 + IL 250 250 3 250 3 19 56 139 175 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 57 ] 53 - A - - - + ML 251 250 3 253 3 20 56 137 173 -9.139 -0.009 -7.793 1.642 -1.665 -1.598 -2.098 + D 252 250 3 253 3 14 51 135 171 -6.174 -1.687 -0.566 + IL 253 253 3 253 3 18 55 138 174 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 58 ] 54 - a - - - + ML 254 253 3 256 3 19 55 136 172 -9.139 -0.009 -7.793 0.482 -0.702 -0.396 0.297 + D 255 253 3 256 3 13 50 134 170 -6.174 -1.687 -0.566 + IL 256 256 3 256 3 18 55 137 173 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 59 ] 55 - u - - - + ML 257 256 3 259 3 18 54 135 171 -9.139 -0.009 -7.793 0.120 -0.025 -1.123 0.557 + D 258 256 3 259 3 13 49 133 169 -6.174 -1.687 -0.566 + IL 259 259 3 259 3 17 54 136 172 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 60 ] 56 - u - - - + ML 260 259 3 262 3 18 53 134 170 -9.139 -0.009 -7.793 -0.737 0.566 -1.404 0.625 + D 261 259 3 262 3 12 49 132 168 -6.174 -1.687 -0.566 + IL 262 262 3 262 3 16 53 135 171 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 61 ] 57 - u - - - + ML 263 262 3 265 3 17 52 133 169 -9.139 -0.009 -7.793 -0.209 0.316 -1.026 0.484 + D 264 262 3 265 3 12 48 131 167 -6.174 -1.687 -0.566 + IL 265 265 3 265 3 16 52 134 170 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 62 ] 58 - u - - - + ML 266 265 3 268 3 16 51 132 168 -9.139 -0.009 -7.793 -0.237 0.407 -1.826 0.626 + D 267 265 3 268 3 11 47 129 166 -6.174 -1.687 -0.566 + IL 268 268 3 268 3 15 51 133 169 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 63 ] 59 - u - - - + ML 269 268 3 271 3 15 50 131 167 -2.679 -0.253 -7.793 -0.411 -0.245 -0.757 0.858 + D 270 268 3 271 3 11 46 127 163 -6.174 -1.687 -0.566 + IL 271 271 3 271 3 15 51 133 169 -0.786 -1.309 -5.921 0.000 0.000 0.000 0.000 + [ MATL 64 ] 64 - u - - - + ML 272 271 3 274 3 14 49 128 164 -9.139 -0.009 -7.793 -0.021 0.020 -0.566 0.406 + D 273 271 3 274 3 10 45 126 161 -6.174 -1.687 -0.566 + IL 274 274 3 274 3 13 49 129 164 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 65 ] 65 - a - - - + ML 275 274 3 277 3 13 48 127 163 -9.139 -0.009 -7.793 0.998 -1.717 0.002 -0.521 + D 276 274 3 277 3 9 45 125 160 -6.174 -1.687 -0.566 + IL 277 277 3 277 3 13 48 128 163 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 66 ] 66 - a - - - + ML 278 277 3 280 3 12 47 126 162 -9.139 -0.049 -4.994 0.767 -0.554 -0.628 -0.045 + D 279 277 3 280 3 9 44 124 159 -6.174 -1.687 -0.566 + IL 280 280 3 280 3 12 47 127 162 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 67 ] 67 - A - - - + ML 281 280 3 283 3 11 46 125 161 -9.100 -0.009 -7.754 1.135 -1.571 -1.039 -0.028 + D 282 280 3 283 3 8 44 123 158 -6.817 -2.330 -0.336 + IL 283 283 3 283 3 11 47 126 161 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 68 ] 68 - A - - - + ML 284 283 3 286 3 10 45 124 160 -9.100 -0.620 -1.525 1.222 -2.045 -0.054 -1.114 + D 285 283 3 286 3 8 43 122 158 -6.817 -2.330 -0.336 + IL 286 286 3 286 3 12 47 125 161 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 69 ] 69 - A - - - + ML 287 286 3 289 3 12 46 123 159 -8.494 -0.014 -7.148 1.081 -1.932 0.311 -1.391 + D 288 286 3 289 3 8 43 122 157 -9.266 -0.893 -1.121 + IL 289 289 3 289 3 11 46 124 160 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 70 ] 70 - a - - - + ML 290 289 3 292 3 11 45 122 158 -9.240 -0.010 -7.558 0.834 -0.533 -0.614 -0.196 + D 291 289 3 292 3 7 42 121 157 -7.193 -0.749 -1.329 + IL 292 292 3 292 3 10 45 123 158 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 71 ] - 185 - U - - + MR 293 292 3 295 3 10 44 121 157 -9.384 -0.009 -7.702 -2.031 -0.180 -2.827 1.450 + D 294 292 3 295 3 6 40 120 156 -7.471 -0.542 -1.701 + IR 295 295 3 295 3 9 43 122 157 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 72 ] - 184 - U - - + MR 296 295 3 298 3 9 43 120 156 -9.476 -0.009 -7.794 -2.652 -1.564 -3.397 1.769 + D 297 295 3 298 3 4 38 118 154 -6.390 -1.568 -0.620 + IR 298 298 3 298 3 8 42 121 156 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 73 ] - 183 - U - - + MR 299 298 3 301 3 8 42 119 155 -9.476 -0.009 -7.794 -0.462 -1.664 -1.426 1.371 + D 300 298 3 301 3 4 37 117 153 -6.390 -1.568 -0.620 + IR 301 301 3 301 3 7 41 120 155 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 74 ] - 182 - u - - + MR 302 301 3 304 3 8 41 118 154 -9.476 -0.063 -4.608 0.494 -0.968 -1.107 0.692 + D 303 301 3 304 3 4 36 116 152 -6.390 -1.568 -0.620 + IR 304 304 3 304 3 7 41 119 154 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 75 ] - 181 - C - - + MR 305 304 3 307 3 9 42 117 153 -9.422 -0.009 -7.740 -1.220 1.048 -0.662 -0.200 + D 306 304 3 307 3 3 35 115 150 -7.123 -2.300 -0.340 + IR 307 307 3 307 3 7 40 118 153 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 76 ] - 180 - G - - + MR 308 307 3 310 3 9 41 116 152 -9.422 -0.009 -7.740 -0.582 -3.196 1.618 -2.701 + D 309 307 3 310 3 3 34 114 149 -7.123 -2.300 -0.340 + IR 310 310 3 310 3 7 40 117 152 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 77 ] - 179 - u - - + MR 311 310 3 313 3 9 40 115 151 -9.422 -0.009 -7.740 -0.097 -0.636 -0.803 0.886 + D 312 310 3 313 3 3 34 113 148 -7.123 -2.300 -0.340 + IR 313 313 3 313 3 6 39 116 151 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 78 ] - 178 - U - - + MR 314 313 3 316 3 8 39 114 150 -9.422 -0.009 -7.740 -3.521 -3.211 -4.310 1.909 + D 315 313 3 316 3 3 33 112 147 -7.123 -2.300 -0.340 + IR 316 316 3 316 3 6 38 115 150 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 79 ] - 177 - u - - + MR 317 316 3 319 3 8 38 113 149 -9.422 -0.009 -7.740 0.248 -0.485 -0.438 0.443 + D 318 316 3 319 3 2 33 111 146 -7.123 -2.300 -0.340 + IR 319 319 3 319 3 6 38 114 149 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 80 ] - 176 - G - - + MR 320 319 3 322 3 8 37 112 148 -9.422 -0.009 -7.740 -0.059 -1.825 1.026 -0.472 + D 321 319 3 322 3 2 32 110 145 -7.123 -2.300 -0.340 + IR 322 322 3 322 3 6 37 113 148 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 81 ] - 175 - U - - + MR 323 322 3 325 3 7 36 111 147 -9.422 -0.009 -7.740 -0.863 -0.161 -2.137 1.219 + D 324 322 3 325 3 2 32 109 144 -7.123 -2.300 -0.340 + IR 325 325 3 325 3 5 36 112 147 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 82 ] - 174 - a - - + MR 326 325 3 328 3 6 35 110 146 -9.422 -0.009 -7.740 0.835 -1.205 0.460 -1.297 + D 327 325 3 328 3 2 32 108 143 -7.123 -2.300 -0.340 + IR 328 328 3 328 3 5 35 111 146 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 83 ] - 173 - u - - + MR 329 328 3 331 3 5 34 109 145 -9.422 -0.009 -7.740 -0.135 -0.224 -0.166 0.424 + D 330 328 3 331 3 2 31 107 143 -7.123 -2.300 -0.340 + IR 331 331 3 331 3 5 34 110 146 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 84 ] - 172 - U - - + MR 332 331 3 334 3 5 33 108 144 -9.422 -0.009 -7.740 -2.410 -1.066 -3.164 1.688 + D 333 331 3 334 3 2 31 106 142 -7.123 -2.300 -0.340 + IR 334 334 3 334 3 4 33 109 145 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 85 ] - 171 - u - - + MR 335 334 3 337 3 4 32 107 143 -9.422 -0.009 -7.740 -0.042 0.059 -0.914 0.542 + D 336 334 3 337 3 2 31 106 141 -7.123 -2.300 -0.340 + IR 337 337 3 337 3 4 33 108 144 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 86 ] - 170 - g - - + MR 338 337 3 340 2 3 31 106 142 -9.624 -0.002 0.040 -1.126 0.681 -0.135 + D 339 337 3 340 2 2 30 105 141 -5.190 -0.040 + IR 340 340 3 340 2 3 32 107 143 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 87 ] - - - - - - + B 341 340 3 342 458 2 30 105 141 + [ BEGL 88 ] - - - - - - + S 342 341 1 343 4 0 0 66 101 -0.073 -7.585 -4.670 -7.633 + [ MATP 89 ] 71 122 a u - - + MP 343 342 1 347 6 2 2 66 101 -9.670 -9.609 -0.120 -3.778 -8.666 -9.061 -3.448 -2.722 -3.587 2.252 -3.861 -4.386 0.121 -1.039 -3.568 1.569 -4.016 2.088 0.377 -3.712 -1.676 -2.586 + ML 344 342 1 347 6 1 1 63 99 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 345 342 1 347 6 1 1 62 98 -7.535 -6.264 -2.173 -6.243 -0.512 -4.456 1.079 -0.951 -0.697 -0.408 + D 346 342 1 347 6 0 0 60 95 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 347 347 5 347 6 1 1 65 101 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 348 348 6 348 5 1 1 65 101 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 90 ] 72 121 g c - - + MP 349 348 6 353 6 2 2 64 100 -9.565 -3.097 -0.194 -8.281 -8.561 -8.956 -1.274 -2.491 -3.242 0.966 -3.686 -3.952 0.387 -3.735 -3.479 2.973 -1.318 0.365 0.596 -3.228 -1.405 -2.326 + ML 350 348 6 353 6 1 1 57 93 -7.496 -7.843 -2.557 -0.343 -7.692 -5.222 0.343 -1.127 0.657 -0.521 + MR 351 348 6 353 6 1 1 59 95 -7.535 -6.264 -2.173 -6.243 -0.512 -4.456 1.079 -0.951 -0.697 -0.408 + D 352 348 6 353 6 0 0 56 92 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 353 353 5 353 6 1 1 64 100 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 354 354 6 354 5 1 1 66 102 -0.741 -1.851 -8.048 -3.127 -7.321 0.000 0.000 0.000 0.000 + [ MATP 91 ] 73 113 G C - - + MP 355 354 6 359 6 2 2 54 79 -9.485 -9.425 -0.016 -8.201 -8.481 -8.876 -4.149 -2.834 -4.081 1.855 -5.108 -4.802 -0.360 -4.582 -4.226 3.068 -4.593 0.787 -0.612 -4.075 -2.343 -2.987 + ML 356 354 6 359 6 1 1 53 78 -7.496 -7.843 -0.418 -2.251 -7.692 -5.222 0.855 -1.057 -0.013 -0.475 + MR 357 354 6 359 6 1 1 53 78 -8.201 -6.930 -0.944 -6.908 -1.213 -5.122 1.495 -1.631 -1.336 -1.110 + D 358 354 6 359 6 0 0 50 75 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 359 359 5 359 6 1 1 54 79 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 360 360 6 360 5 1 1 54 79 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 92 ] 74 112 G C - - + MP 361 360 6 365 6 2 2 52 77 -9.672 -9.611 -0.014 -8.388 -8.668 -9.063 -5.118 -3.525 -5.194 -0.057 -6.500 -5.658 -1.649 -5.526 -4.847 3.290 -5.262 2.085 -1.868 -5.178 -3.658 -3.991 + ML 362 360 6 365 6 1 1 51 76 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 363 360 6 365 6 1 1 50 75 -7.511 -6.240 -2.149 -6.218 -0.523 -4.432 1.060 -0.929 -0.675 -0.388 + D 364 360 6 365 6 0 0 48 73 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 365 365 5 365 6 1 1 52 77 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 366 366 6 366 5 1 1 52 77 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 93 ] 75 111 G C - - + MP 367 366 6 371 6 2 2 50 75 -9.672 -9.611 -0.014 -8.388 -8.668 -9.063 -4.661 -0.303 -4.618 0.321 -5.771 -5.129 -0.932 -5.124 -4.624 3.216 -4.970 1.674 -1.175 -4.522 -2.929 -3.511 + ML 368 366 6 371 6 1 1 49 74 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 369 366 6 371 6 1 1 49 74 -7.511 -6.240 -0.916 -6.218 -1.352 -4.432 1.060 -0.929 -0.675 -0.388 + D 370 366 6 371 6 0 0 46 71 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 371 371 5 371 6 1 1 50 75 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 372 372 6 372 5 1 1 50 75 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 94 ] 76 110 u a - - + MP 373 372 6 377 6 2 2 48 73 -9.708 -9.648 -0.243 -3.001 -8.704 -5.317 -3.252 -3.270 -3.362 0.210 -2.854 -4.178 1.283 -3.369 -3.367 0.319 -3.898 -0.354 2.797 -3.534 -0.039 0.688 + ML 374 372 6 377 6 1 1 47 72 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 375 372 6 377 6 1 1 47 72 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 376 372 6 377 6 0 0 44 69 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 377 377 5 377 6 1 1 48 73 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 378 378 6 378 5 1 1 48 73 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 95 ] 77 109 G U - - + MP 379 378 6 383 6 2 2 46 72 -9.482 -9.421 -0.016 -8.198 -8.478 -8.873 -4.423 -3.062 -4.614 1.209 -6.143 -6.413 -1.551 -4.698 -4.230 1.617 -4.781 3.231 -1.699 -5.398 -3.475 -3.263 + ML 380 378 6 383 6 1 1 45 70 -8.041 -8.387 -3.102 -0.226 -8.237 -5.767 -1.395 -2.585 1.677 -1.971 + MR 381 378 6 383 6 1 1 45 70 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 382 378 6 383 6 0 0 43 68 -9.725 -8.423 -4.220 -4.902 -4.920 -0.191 + IL 383 383 5 383 6 1 1 46 71 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 384 384 6 384 5 1 1 46 71 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 96 ] 78 108 a u - - + MP 385 384 6 389 4 2 2 44 70 -7.777 -7.984 -0.030 -6.398 -2.742 -1.038 -2.832 2.371 -3.062 -1.161 0.658 -3.249 -2.985 2.184 -3.466 -0.359 0.457 -2.887 -1.008 -1.978 + ML 386 384 6 389 4 1 1 44 69 -5.261 -5.443 -0.159 -4.173 -1.395 -2.585 1.677 -1.971 + MR 387 384 6 389 4 1 1 44 69 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 388 384 6 389 4 0 0 42 67 -5.208 -4.890 -2.905 -0.312 + IL 389 389 5 389 4 1 1 45 70 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 390 390 6 390 3 1 1 45 70 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 97 ] 79 - U - - - + ML 391 390 6 393 3 1 1 42 67 -9.422 -0.009 -7.739 -3.520 -3.210 -4.309 1.909 + D 392 390 6 393 3 0 0 41 66 -6.189 -0.451 -1.972 + IL 393 393 3 393 3 1 1 43 68 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 98 ] - 107 - a - - + MR 394 393 3 396 5 1 1 41 66 -8.162 -0.018 -7.977 -8.190 -9.081 0.498 -0.745 -0.674 0.448 + D 395 393 3 396 5 0 0 40 65 -5.352 -0.707 -2.978 -4.409 -2.404 + IR 396 396 3 396 5 1 1 42 67 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 99 ] 80 106 g u - - + MP 397 396 3 401 6 2 2 40 65 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -1.245 0.552 -3.986 0.318 -3.958 -1.407 0.956 -2.369 -0.317 0.488 -0.376 2.416 -0.351 -2.173 -0.896 -1.432 + ML 398 396 3 401 6 1 1 39 64 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 399 396 3 401 6 1 1 39 64 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 400 396 3 401 6 0 0 36 61 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 401 401 5 401 6 1 1 40 65 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 402 402 6 402 5 1 1 40 65 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 100 ] 81 105 C G - - + MP 403 402 6 407 4 2 2 38 63 -8.183 -2.214 -0.373 -6.804 -4.532 -4.549 -4.416 -0.810 -0.600 -4.989 3.309 0.337 -4.421 -0.685 -4.817 -2.584 0.948 -4.687 -1.019 -3.305 + ML 404 402 6 407 4 1 1 37 62 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 405 402 6 407 4 1 1 36 62 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 406 402 6 407 4 0 0 35 60 -4.568 -4.250 -2.265 -0.520 + IL 407 407 5 407 4 1 1 39 64 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 408 408 6 408 3 1 1 38 64 -1.060 -0.991 -5.859 0.000 0.000 0.000 0.000 + [ MATL 101 ] 82 - C - - - + ML 409 408 6 411 3 1 1 31 52 -4.432 -0.075 -7.793 -1.758 1.415 -1.464 -0.565 + D 410 408 6 411 3 0 0 29 49 -6.174 -1.687 -0.566 + IL 411 411 3 411 3 1 1 33 54 -1.286 -0.859 -4.695 0.000 0.000 0.000 0.000 + [ MATL 102 ] 85 - U - - - + ML 412 411 3 414 3 1 1 28 47 -9.139 -0.009 -7.793 -3.610 -3.290 -4.399 1.914 + D 413 411 3 414 3 0 0 27 46 -6.174 -1.687 -0.566 + IL 414 414 3 414 3 1 1 31 50 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 103 ] 86 - A - - - + ML 415 414 3 417 3 1 1 27 46 -9.139 -0.009 -7.793 1.620 -1.548 -1.558 -2.027 + D 416 414 3 417 3 0 0 26 45 -6.174 -1.687 -0.566 + IL 417 417 3 417 3 1 1 30 49 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 104 ] 87 - U - - - + ML 418 417 3 420 3 1 1 26 44 -9.139 -0.009 -7.793 -3.610 -3.290 -4.399 1.914 + D 419 417 3 420 3 0 0 25 44 -6.174 -1.687 -0.566 + IL 420 420 3 420 3 1 1 29 48 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 105 ] 88 - G - - - + ML 421 420 3 423 3 1 1 25 43 -9.139 -0.009 -7.793 -2.230 -3.221 1.710 -1.295 + D 422 420 3 423 3 0 0 24 43 -6.174 -1.687 -0.566 + IL 423 423 3 423 3 1 1 28 47 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 106 ] 89 - g - - - + ML 424 423 3 426 3 1 1 23 42 -9.139 -0.009 -7.793 0.258 -0.988 0.388 -0.013 + D 425 423 3 426 3 0 0 23 42 -6.174 -1.687 -0.566 + IL 426 426 3 426 3 1 1 27 45 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 107 ] 90 - u - - - + ML 427 426 3 429 3 1 1 22 41 -9.139 -0.009 -7.793 0.156 -1.321 -0.228 0.706 + D 428 426 3 429 3 0 0 22 41 -6.174 -1.687 -0.566 + IL 429 429 3 429 3 1 1 26 44 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 108 ] 91 - U - - - + ML 430 429 3 432 3 1 1 21 40 -9.139 -0.067 -4.519 -1.681 -0.928 -1.545 1.495 + D 431 429 3 432 3 0 0 21 39 -6.174 -1.687 -0.566 + IL 432 432 3 432 3 1 1 25 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 109 ] 92 - a - - - + ML 433 432 3 435 3 1 1 20 39 -9.081 -0.009 -7.736 0.260 -0.992 0.256 0.145 + D 434 432 3 435 3 0 0 19 38 -7.035 -2.548 -0.284 + IL 435 435 3 435 3 1 1 24 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 110 ] 93 - u - - - + ML 436 435 3 438 3 1 1 19 38 -9.081 -0.009 -7.736 0.338 -0.493 -1.541 0.750 + D 437 435 3 438 3 0 0 18 37 -7.035 -2.548 -0.284 + IL 438 438 3 438 3 1 1 22 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 111 ] 94 - a - - - + ML 439 438 3 441 3 1 1 18 36 -9.081 -0.009 -7.736 0.876 -1.119 -1.138 0.322 + D 440 438 3 441 3 0 0 17 36 -7.035 -2.548 -0.284 + IL 441 441 3 441 3 1 1 21 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 112 ] 95 - u - - - + ML 442 441 3 444 3 1 1 17 35 -9.081 -0.508 -1.762 0.346 -0.919 -0.260 0.448 + D 443 441 3 444 3 0 0 16 35 -7.035 -2.548 -0.284 + IL 444 444 3 444 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 113 ] 96 - u - - - + ML 445 444 3 447 3 1 1 16 34 -8.587 -0.013 -7.241 -0.557 -0.665 0.209 0.617 + D 446 444 3 447 3 0 0 14 32 -9.107 -3.131 -0.178 + IL 447 447 3 447 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 114 ] 97 - u - - - + ML 448 447 3 450 3 1 1 14 33 -8.643 -0.013 -7.297 0.449 -0.674 -0.840 0.536 + D 449 447 3 450 3 0 0 13 31 -8.997 -2.679 -0.248 + IL 450 450 3 450 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 115 ] 98 - u - - - + ML 451 450 3 453 3 1 1 13 31 -8.718 -0.012 -7.372 0.318 -0.285 -0.883 0.476 + D 452 450 3 453 3 0 0 11 30 -8.825 -4.338 -0.077 + IL 453 453 3 453 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 116 ] 99 - u - - - + ML 454 453 3 456 2 1 1 1 1 * 0.000 -0.368 -0.379 -0.639 0.859 + D 455 453 3 456 2 0 0 0 0 * 0.000 + IL 456 456 3 456 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 117 ] - - - - - - + E 457 456 3 -1 0 0 0 0 0 + [ BEGR 118 ] - - - - - - + S 458 341 1 459 3 0 5 63 94 -9.139 -0.009 -7.793 + IL 459 459 2 459 3 1 5 65 96 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 119 ] 123 - A - - - + ML 460 459 2 462 3 1 5 63 94 -4.553 -0.070 -7.793 1.451 -2.211 -0.640 -1.294 + D 461 459 2 462 3 0 0 61 92 -6.174 -1.687 -0.566 + IL 462 462 3 462 3 1 4 64 94 -1.722 -0.621 -4.422 0.000 0.000 0.000 0.000 + [ MATL 120 ] 125 - G - - - + ML 463 462 3 465 3 1 4 62 92 -9.139 -0.070 -4.451 -3.674 -5.130 1.943 -4.412 + D 464 462 3 465 3 0 0 60 91 -6.174 -1.687 -0.566 + IL 465 465 3 465 3 1 4 63 94 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 121 ] 126 - A - - - + ML 466 465 3 468 3 1 5 61 92 -9.078 -0.009 -7.732 1.827 -3.448 -1.997 -3.200 + D 467 465 3 468 3 0 0 60 90 -7.070 -0.668 -1.461 + IL 468 468 3 468 3 1 3 62 93 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 122 ] 127 - A - - - + ML 469 468 3 471 3 1 5 60 91 -9.139 -0.009 -7.793 1.943 -4.574 -4.039 -4.293 + D 470 468 3 471 3 0 0 58 89 -6.174 -1.687 -0.566 + IL 471 471 3 471 3 1 2 61 92 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 123 ] 128 - A - - - + ML 472 471 3 474 3 1 4 59 90 -9.139 -0.009 -7.793 1.732 -2.720 -2.773 -1.396 + D 473 471 3 474 3 0 0 57 88 -6.174 -1.687 -0.566 + IL 474 474 3 474 3 1 2 60 91 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 124 ] 129 - G - - - + ML 475 474 3 477 3 1 4 58 89 -9.139 -0.009 -7.793 -3.674 -5.130 1.943 -4.412 + D 476 474 3 477 3 0 0 56 86 -6.174 -1.687 -0.566 + IL 477 477 3 477 3 1 1 59 90 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 125 ] 130 - G - - - + ML 478 477 3 480 3 1 3 57 88 -9.139 -0.009 -7.793 -2.793 -3.926 1.845 -2.347 + D 479 477 3 480 3 0 0 55 85 -6.174 -1.687 -0.566 + IL 480 480 3 480 3 1 1 58 88 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 126 ] 131 - A - - - + ML 481 480 3 483 3 1 3 56 87 -3.376 -0.153 -7.793 1.815 -2.227 -2.993 -2.815 + D 482 480 3 483 3 0 0 53 83 -6.174 -1.687 -0.566 + IL 483 483 3 483 3 1 1 58 89 -0.916 -1.164 -5.404 0.000 0.000 0.000 0.000 + [ MATL 127 ] 137 - a - - - + ML 484 483 3 486 3 1 2 53 83 -9.139 -0.009 -7.793 0.174 -0.241 0.160 -0.139 + D 485 483 3 486 3 0 0 51 81 -6.174 -1.687 -0.566 + IL 486 486 3 486 3 1 1 54 84 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 128 ] 138 - u - - - + ML 487 486 3 489 3 1 2 52 82 -9.139 -0.009 -7.793 0.585 -1.621 -1.854 0.925 + D 488 486 3 489 3 0 0 50 80 -6.174 -1.687 -0.566 + IL 489 489 3 489 3 1 1 53 83 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 129 ] 139 - A - - - + ML 490 489 3 492 3 1 1 51 81 -9.139 -0.210 -2.902 1.486 -1.254 -1.552 -1.186 + D 491 489 3 492 3 0 0 49 79 -6.174 -1.687 -0.566 + IL 492 492 3 492 3 1 1 53 83 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 130 ] 140 - G - - - + ML 493 492 3 495 3 1 1 51 81 -1.846 -0.481 -7.593 0.088 -1.563 1.169 -1.512 + D 494 492 3 495 3 0 0 43 73 -8.061 -0.298 -2.453 + IL 495 495 3 495 3 1 1 52 82 -0.886 -1.167 -6.185 0.000 0.000 0.000 0.000 + [ MATL 131 ] 145 - u - - - + ML 496 495 3 498 3 1 1 39 57 -9.139 -0.009 -7.793 -0.242 0.050 -0.213 0.330 + D 497 495 3 498 3 0 0 38 57 -6.174 -1.687 -0.566 + IL 498 498 3 498 3 1 1 41 60 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 132 ] 146 - c - - - + ML 499 498 3 501 3 1 1 37 56 -9.139 -0.009 -7.793 -0.429 0.772 -2.018 0.381 + D 500 498 3 501 3 0 0 37 56 -6.174 -1.687 -0.566 + IL 501 501 3 501 3 1 1 40 59 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 133 ] 147 - u - - - + ML 502 501 3 504 3 1 1 36 55 -9.139 -0.009 -7.793 0.487 -1.325 -0.662 0.648 + D 503 501 3 504 3 0 0 35 54 -6.174 -1.687 -0.566 + IL 504 504 3 504 3 1 1 39 58 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 134 ] 148 - U - - - + ML 505 504 3 507 5 1 1 35 54 -8.162 -0.018 -7.977 -8.190 -9.081 -1.400 -2.268 -3.017 1.718 + D 506 504 3 507 5 0 0 34 53 -4.959 -0.803 -4.221 -2.596 -2.508 + IL 507 507 3 507 5 1 1 36 55 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 135 ] 149 169 g c - - + MP 508 507 3 512 6 2 2 34 53 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -4.272 -3.043 -4.239 1.082 -5.196 -5.015 -0.608 -4.713 0.453 2.936 -4.748 1.563 -0.844 -4.276 -2.544 -3.158 + ML 509 507 3 512 6 1 1 33 52 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 510 507 3 512 6 1 1 33 52 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 511 507 3 512 6 0 0 31 50 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 512 512 5 512 6 1 1 34 53 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 513 513 6 513 5 1 1 34 53 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 136 ] 150 168 u a - - + MP 514 513 6 518 6 2 2 32 51 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -0.075 -2.052 -2.047 1.286 -2.017 -2.898 1.192 -2.383 -2.113 0.725 -2.684 -0.706 2.084 -0.146 -0.251 -0.655 + ML 515 513 6 518 6 1 1 32 51 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 516 513 6 518 6 1 1 32 51 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 517 513 6 518 6 0 0 30 49 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 518 518 5 518 6 1 1 32 51 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 519 519 6 519 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 137 ] 151 167 c g - - + MP 520 519 6 524 4 2 2 30 49 -8.183 -8.390 -0.022 -6.804 -2.439 -2.594 -2.606 0.537 0.193 -3.442 2.329 0.755 -1.109 0.909 -3.208 -1.077 0.985 -2.757 -0.428 -1.779 + ML 521 519 6 524 4 1 1 32 51 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 522 519 6 524 4 1 1 31 50 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 523 519 6 524 4 0 0 30 49 -4.568 -4.250 -2.265 -0.520 + IL 524 524 5 524 4 1 1 33 52 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 525 525 6 525 3 1 1 32 51 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 138 ] 152 - u - - - + ML 526 525 6 528 3 1 1 28 46 -9.476 -0.101 -3.921 -0.169 0.250 -1.772 0.703 + D 527 525 6 528 3 0 0 27 45 -5.620 -0.734 -1.403 + IL 528 528 3 528 3 1 1 29 47 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 139 ] - 166 - U - - + MR 529 528 3 531 5 1 1 27 45 -8.073 -0.020 -7.889 -8.101 -8.993 -3.458 -3.155 -4.245 1.905 + D 530 528 3 531 5 0 0 26 44 -6.052 -0.393 -3.679 -5.110 -3.104 + IR 531 531 3 531 5 1 1 27 46 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 140 ] 153 165 g c - - + MP 532 531 3 536 6 2 2 26 44 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -3.293 -2.514 -3.352 1.104 -3.794 -4.006 0.203 -3.812 -0.101 2.684 -3.898 1.204 -0.021 -0.189 -1.556 -2.427 + ML 533 531 3 536 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 534 531 3 536 6 1 1 24 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 535 531 3 536 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 536 536 5 536 6 1 1 26 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 537 537 6 537 5 1 1 25 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 141 ] 154 164 u a - - + MP 538 537 6 542 6 2 2 24 42 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -1.750 -1.965 -0.081 0.903 -0.508 -1.281 1.173 -2.300 -1.101 0.712 -2.589 -0.662 1.992 -1.150 0.128 -0.651 + ML 539 537 6 542 6 1 1 23 42 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 540 537 6 542 6 1 1 23 41 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 541 537 6 542 6 0 0 21 40 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 542 542 5 542 6 1 1 24 42 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 543 543 6 543 5 1 1 23 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 142 ] 155 163 c g - - + MP 544 543 6 548 6 2 2 22 40 -9.708 -9.648 -0.014 -8.424 -8.704 -9.099 -1.760 -0.218 -1.981 1.269 -1.976 -1.388 1.291 -1.097 -2.008 1.165 -2.544 -0.495 1.036 0.066 0.078 0.146 + ML 545 543 6 548 6 1 1 22 41 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 546 543 6 548 6 1 1 22 40 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 547 543 6 548 6 0 0 20 39 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 548 548 5 548 6 1 1 22 41 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 549 549 6 549 5 1 1 22 40 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 143 ] 156 162 u a - - + MP 550 549 6 554 4 2 2 20 38 -8.183 -8.390 -0.022 -6.804 -5.321 -5.381 -4.959 -1.543 -3.557 -5.322 1.423 -4.385 -4.996 -1.416 -5.264 -3.422 2.720 -5.340 2.467 -3.818 + ML 551 549 6 554 4 1 1 21 40 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 552 549 6 554 4 1 1 21 40 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 553 549 6 554 4 0 0 20 39 -4.568 -4.250 -2.265 -0.520 + IL 554 554 5 554 4 1 1 23 42 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 555 555 6 555 3 1 1 22 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 144 ] 157 - a - - - + ML 556 555 6 558 3 1 1 17 35 -9.139 -0.009 -7.793 0.728 -0.739 -1.547 0.488 + D 557 555 6 558 3 0 0 17 35 -6.174 -1.687 -0.566 + IL 558 558 3 558 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 145 ] 158 - U - - - + ML 559 558 3 561 3 1 1 15 34 -9.139 -0.009 -7.793 -0.490 -0.821 -1.422 1.232 + D 560 558 3 561 3 0 0 16 34 -6.174 -1.687 -0.566 + IL 561 561 3 561 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 146 ] 159 - G - - - + ML 562 561 3 564 3 1 1 14 32 -9.139 -0.009 -7.793 -2.544 -3.611 1.796 -1.871 + D 563 561 3 564 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 564 564 3 564 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 147 ] 160 - A - - - + ML 565 564 3 567 3 1 1 12 31 -9.139 -0.009 -7.793 1.773 -2.890 -2.911 -1.673 + D 566 564 3 567 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 567 567 3 567 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 148 ] 161 - A - - - + ML 568 567 3 570 2 1 1 1 1 * 0.000 1.448 -1.663 -0.573 -1.820 + D 569 567 3 570 2 0 0 0 0 * 0.000 + IL 570 570 3 570 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 149 ] - - - - - - + E 571 570 3 -1 0 0 0 0 0 +// +HMMER3/f [3.4 | Aug 2023] +NAME rli28 +ACC RF01492 +DESC Listeria sRNA rli28 +LENG 186 +MAXL 291 +ALPH RNA +RF no +MM no +CONS yes +CS yes +MAP yes +DATE Sun Jul 7 10:11:55 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF01492/CM +NSEQ 21 +EFFN 3.765747 +CKSUM 3682069606 +STATS LOCAL MSV -10.6999 0.71365 +STATS LOCAL VITERBI -12.1497 0.71365 +STATS LOCAL FORWARD -3.3972 0.71365 +HMM A C G U + m->m m->i m->d i->m i->i d->m d->d + COMPO 1.27138 1.72891 1.44163 1.18569 + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 0.00000 * + 1 1.34068 1.83555 1.43034 1.08005 1 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 2 1.39980 2.11877 1.81240 0.75521 2 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 3 1.02221 1.79489 1.95836 1.09971 3 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 4 1.09250 1.59258 2.02399 1.11140 4 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 5 1.50824 1.56742 1.68357 0.95605 5 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 6 1.23816 1.89883 2.32539 0.77091 6 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 7 0.41897 2.52028 2.17879 1.90610 7 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 8 3.16656 3.03977 3.70092 0.12182 8 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 9 2.76773 3.52445 0.16749 2.78160 9 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 10 1.36119 1.36534 1.71281 1.17768 10 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 11 2.44471 2.50214 2.59429 0.27887 11 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 12 0.31523 2.72456 2.33699 2.22392 12 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 13 1.95396 1.94063 2.69958 0.43473 13 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 14 0.23420 2.92357 2.88417 2.31107 14 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 15 0.41627 2.27253 2.53774 1.84261 15 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.62873 0.95894 2.48377 0.93209 0.50043 1.09861 0.40547 + 16 2.01599 2.04548 2.45424 0.42838 19 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03275 4.12828 4.12828 1.46634 0.26236 0.30733 1.32957 + 17 0.94931 1.94992 1.79848 1.18693 20 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 18 0.69553 1.86164 1.88655 1.63897 21 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 19 0.85637 1.82070 2.02554 1.26775 22 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 20 1.09508 1.81704 1.63969 1.17461 23 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 21 1.31645 1.87941 1.07180 1.44037 24 g - - : + 1.38629 1.38629 1.38629 1.38629 + 0.19494 4.19916 1.81948 1.46634 0.26236 1.09861 0.40547 + 22 1.31343 1.50478 2.00345 0.98305 25 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03583 4.04004 4.04004 1.46634 0.26236 2.54955 0.08134 + 23 0.97534 1.89390 1.56698 1.33265 26 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.11792 4.04004 2.36835 1.46634 0.26236 2.54955 0.08134 + 24 1.73943 2.50273 0.53538 1.85104 27 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03883 3.96096 3.96096 1.46634 0.26236 1.63882 0.21593 + 25 1.79327 1.41200 2.01799 0.78306 28 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03716 4.00429 4.00429 1.46634 0.26236 0.14521 2.00129 + 26 0.08362 3.81922 3.49124 3.58235 29 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 27 1.81527 3.22226 0.30200 2.84728 30 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 28 1.32848 1.19018 1.79529 1.32850 31 c - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 29 0.26808 2.36072 2.78283 2.53906 32 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 30 0.08362 3.81922 3.49124 3.58235 33 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.14279 4.19916 2.13659 1.46634 0.26236 1.09861 0.40547 + 31 0.61642 2.39055 1.54038 1.86918 34 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03404 4.09040 4.09040 1.46634 0.26236 0.61944 0.77272 + 32 2.15390 2.72778 0.44148 1.74000 35 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03171 4.16004 4.16004 1.46634 0.26236 1.71483 0.19844 + 33 3.09373 2.97825 3.62639 0.13105 36 U - - : + 1.38629 1.38629 1.38629 1.38629 + 0.33876 4.16004 1.30292 1.46634 0.26236 0.44627 1.02169 + 34 1.87810 2.41492 0.59606 1.57617 37 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.04064 3.91639 3.91639 1.46634 0.26236 1.78917 0.18284 + 35 1.07872 2.03157 1.44294 1.22892 38 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03887 3.96010 3.96010 1.46634 0.26236 0.29910 1.35281 + 36 0.84788 2.14766 1.68827 1.30903 39 a - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03165 4.16188 4.16188 1.46634 0.26236 0.45851 1.00028 + 37 1.00917 2.18753 2.34832 0.84921 40 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 38 0.16985 3.17983 3.07063 2.68493 41 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.40957 4.19916 1.13613 1.46634 0.26236 1.09861 0.40547 + 39 1.08390 1.97875 2.14630 0.90000 42 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.04422 3.83380 3.83380 1.46634 0.26236 0.08938 2.45925 + 40 2.47213 3.67515 0.15915 3.28670 43 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 41 0.44391 2.35364 1.85585 2.23370 44 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 42 1.98990 1.23311 2.32202 0.74690 45 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 43 2.18235 3.11765 0.27201 2.51191 46 G - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 44 1.67940 1.85721 0.78126 1.61154 47 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 45 2.00246 1.52601 1.90330 0.69611 48 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 46 1.65561 1.89311 0.69413 1.83941 49 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 47 2.03424 2.61388 0.34187 2.45891 50 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 48 2.92069 0.35422 2.74792 1.71302 51 C - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 49 1.85813 2.03710 2.11347 0.52288 52 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 50 0.33857 2.38276 2.28701 2.37143 53 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 51 1.07998 1.80759 1.65687 1.18543 54 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 52 1.29813 1.43088 2.06317 1.01940 55 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 53 1.72664 1.09536 2.20805 0.97343 56 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 54 1.47056 1.23741 2.01839 1.05785 57 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 55 1.48635 1.19119 2.37743 0.97510 58 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 56 1.57868 1.55570 1.88738 0.84108 59 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.17746 1.91327 4.19916 1.12714 0.39150 1.09861 0.40547 + 57 1.36584 1.41023 1.76734 1.10878 64 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 58 0.77122 2.29864 1.42026 1.63216 65 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 59 0.90665 1.74171 1.78331 1.37507 66 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.05423 4.19916 3.27598 1.46634 0.26236 1.09861 0.40547 + 60 0.68916 2.21708 1.98674 1.37858 67 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03120 4.17612 4.17612 1.46634 0.26236 1.50791 0.25022 + 61 0.63195 2.44590 1.45421 1.90911 68 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.38958 4.17612 1.17993 1.46634 0.26236 1.50791 0.25022 + 62 0.73408 2.37061 1.24626 1.97290 69 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.04435 3.83089 3.83089 1.46634 0.26236 0.61850 0.77382 + 63 0.86830 1.73533 1.76942 1.45431 70 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.08055 4.05662 2.81196 1.46634 0.26236 0.18483 1.77931 + 64 1.29185 1.92769 0.87467 1.81552 71 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03167 4.16135 4.16135 1.46634 0.26236 1.69960 0.20182 + 65 1.65661 2.01493 0.69029 1.74609 72 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.10802 4.16135 2.44414 1.46634 0.26236 1.69960 0.20182 + 66 1.42903 2.52022 0.53524 2.35929 73 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03414 4.08748 4.08748 1.46634 0.26236 0.56349 0.84216 + 67 2.21311 3.06287 0.23743 2.89615 74 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03160 4.16363 4.16363 1.46634 0.26236 1.67248 0.20798 + 68 1.84010 2.75863 0.35191 2.59724 75 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03160 4.16363 4.16363 1.46634 0.26236 0.47090 0.97933 + 69 2.05282 1.57121 1.77024 0.70615 76 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06481 4.19916 3.04186 1.46634 0.26236 1.09861 0.40547 + 70 1.70373 2.85354 0.37197 2.64534 77 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03152 4.16587 4.16587 1.46634 0.26236 1.64506 0.21443 + 71 1.19822 1.86377 0.99126 1.75984 78 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03152 4.16587 4.16587 1.46634 0.26236 1.64506 0.21443 + 72 3.10463 2.98744 3.63755 0.12962 79 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03152 4.16587 4.16587 1.46634 0.26236 0.48776 0.95191 + 73 1.59651 1.70719 0.83853 1.69458 80 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 74 2.42056 0.52954 2.24872 1.52915 81 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 75 2.16768 0.54183 2.27502 1.60406 82 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.07082 2.93059 4.19916 0.89349 0.52632 1.09861 0.40547 + 76 3.16656 3.03977 3.70092 0.12182 85 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 77 0.35691 2.31855 2.26172 2.32708 86 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 78 3.16656 3.03977 3.70092 0.12182 87 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 79 2.41940 3.06809 0.28936 2.15613 88 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 80 1.20217 1.96642 1.19160 1.36349 89 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 81 1.26855 2.09368 1.56684 0.94978 90 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 82 2.12814 1.89620 2.29692 0.46166 91 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06581 4.19916 3.02246 1.46634 0.26236 1.09861 0.40547 + 83 1.20290 1.96140 1.27296 1.27649 92 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03156 4.16490 4.16490 1.46634 0.26236 1.65702 0.21159 + 84 1.17838 1.68410 2.25274 0.91254 93 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03156 4.16490 4.16490 1.46634 0.26236 1.65702 0.21159 + 85 0.85128 2.00506 2.04609 1.17364 94 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03156 4.16490 4.16490 1.46634 0.26236 1.65702 0.21159 + 86 1.16006 1.91200 1.58074 1.09984 95 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.32482 4.16490 1.34012 1.46634 0.26236 1.65702 0.21159 + 87 1.61439 1.77966 1.32967 1.00041 96 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.04209 3.88217 3.88217 1.46634 0.26236 2.12614 0.12703 + 88 1.11030 1.78022 1.90538 1.04080 97 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.04078 3.91295 3.91295 1.46634 0.26236 1.81740 0.17727 + 89 1.18495 1.57843 1.93243 1.06960 98 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03905 3.95562 3.95562 1.46634 0.26236 2.85660 0.05918 + 90 1.55230 1.62711 1.81695 0.84578 99 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.30517 1.41119 3.95562 0.80122 0.59562 0.12209 2.16346 + 91 1.62189 2.42164 0.58565 1.85179 105 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 92 1.72908 1.56888 1.43472 0.97792 106 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 93 1.07422 1.82268 1.81518 1.09650 107 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.26722 4.19916 1.51647 1.46634 0.26236 1.09861 0.40547 + 94 1.95225 1.11269 1.70189 1.05834 108 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03846 3.97040 3.97040 1.46634 0.26236 2.81087 0.06204 + 95 2.88002 1.36244 2.65369 0.48217 109 U - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03846 3.97040 3.97040 1.46634 0.26236 0.12818 2.11772 + 96 0.95016 2.03045 1.34767 1.50418 110 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 97 2.76712 0.54065 2.56853 1.27963 111 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 98 3.00659 0.53490 2.87811 1.17581 112 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.13411 4.19916 2.20274 1.46634 0.26236 1.09861 0.40547 + 99 2.40490 0.69626 2.34771 1.15299 113 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.21741 1.72143 4.09879 1.28394 0.32427 2.23672 0.11295 + 100 1.83733 0.84463 1.73893 1.44675 121 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03375 4.09879 4.09879 1.46634 0.26236 0.24031 1.54358 + 101 1.94895 1.42542 1.84773 0.77746 122 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 102 0.47626 2.54009 1.78849 2.01870 123 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06712 2.99758 4.19916 0.52098 0.90125 1.09861 0.40547 + 103 3.27086 4.21474 0.07864 3.77747 125 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06763 4.19916 2.98802 1.46634 0.26236 1.09861 0.40547 + 104 0.18553 3.22422 2.55020 2.96644 126 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03161 4.16314 4.16314 1.46634 0.26236 0.46732 0.98531 + 105 0.08362 3.81922 3.49124 3.58235 127 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 106 0.26879 2.82086 2.80564 2.15701 128 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 107 3.27086 4.21474 0.07864 3.77747 129 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 108 2.76773 3.52445 0.16749 2.78160 130 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 109 0.19878 2.72249 2.93995 2.78565 131 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.11728 2.34704 4.19916 1.09528 0.40714 1.09861 0.40547 + 110 1.24882 1.57952 1.33219 1.41394 137 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 111 1.03508 2.18794 2.35467 0.82615 138 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 112 0.45990 2.12970 2.23231 1.94843 139 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.15112 4.19916 2.07747 1.46634 0.26236 1.09861 0.40547 + 113 1.27316 2.27937 0.71309 2.05902 140 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.30837 1.39234 4.08236 0.93927 0.49580 0.21484 1.64337 + 114 1.47406 1.40020 1.56750 1.15236 145 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 115 1.57989 0.96963 2.45585 1.11173 146 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 116 1.08342 2.09365 1.80532 0.98375 147 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 117 2.12027 2.50236 2.95043 0.29331 148 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 118 1.77325 2.48235 0.43305 2.32131 149 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 119 1.44905 1.60017 1.65359 0.98891 150 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 120 1.81993 0.93157 1.60719 1.41232 151 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 121 1.45326 1.28164 2.35658 0.93174 152 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 122 1.69545 2.01097 0.70676 1.66399 153 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 123 1.52661 1.47104 1.61893 1.03583 154 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 124 1.44974 1.48402 1.49661 1.15596 155 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 125 2.83167 1.47692 2.63010 0.44523 156 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 126 0.94659 1.81464 2.24447 1.06986 157 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 127 1.63210 1.84780 2.22742 0.61787 158 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 128 2.61470 3.32303 0.21188 2.50464 159 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 129 0.23420 2.92357 2.88417 2.31107 160 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 130 0.48255 2.33075 1.74889 2.19283 161 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 131 0.98275 2.79627 0.71186 2.60438 162 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 132 1.61055 1.37751 1.33988 1.25128 163 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 133 1.18603 1.71731 1.25271 1.47276 164 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 134 1.84375 0.93144 1.81156 1.25740 165 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.08841 4.19916 2.66491 1.46634 0.26236 1.09861 0.40547 + 135 3.06179 2.95134 3.59366 0.13533 166 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03226 4.14301 4.14301 1.46634 0.26236 0.35854 1.19964 + 136 1.42566 1.81532 1.05149 1.39655 167 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 137 1.16093 1.66291 1.39231 1.39144 168 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 138 2.03413 0.77580 2.28446 1.18077 169 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06415 4.19916 3.05499 1.46634 0.26236 1.09861 0.40547 + 139 1.31625 2.03314 1.01990 1.42585 170 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 140 1.38438 1.38493 1.95898 1.02673 171 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 141 2.51261 1.98922 3.03424 0.30920 172 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 142 1.42128 1.55209 1.53820 1.10255 173 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 143 0.86980 2.09333 1.15742 1.94219 174 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 144 1.79943 1.50584 2.52394 0.62992 175 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 145 1.36299 2.34841 0.80194 1.60880 176 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 146 1.21778 1.68872 1.68776 1.09534 177 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 147 3.10528 2.98799 3.63822 0.12954 178 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 148 1.42196 1.75935 1.90696 0.82537 179 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 149 1.68667 3.10707 0.34981 2.72864 180 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 1.63702 0.21637 + 150 1.90181 0.80375 1.82602 1.41881 181 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 0.49285 0.94387 + 151 1.08422 1.92544 2.04669 0.94969 182 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 152 1.60659 2.21421 2.21126 0.54365 183 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 153 2.67713 2.25983 3.19569 0.24088 184 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.08841 4.19916 2.66491 1.46634 0.26236 1.09861 0.40547 + 154 2.28752 1.50844 2.82435 0.48146 185 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03226 4.14301 4.14301 1.46634 0.26236 0.35854 1.19964 + 155 1.39395 2.91669 0.46060 2.70469 186 G - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 156 2.70095 0.79061 1.64409 1.25142 187 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.06415 4.19916 3.05499 1.46634 0.26236 1.09861 0.40547 + 157 1.66163 1.50074 1.57014 0.96972 188 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.03150 4.16651 4.16651 1.46634 0.26236 0.49285 0.94387 + 158 0.90970 1.92055 1.24214 1.81978 189 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 159 1.80715 1.04459 1.41137 1.42614 190 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 160 1.41377 1.53435 1.65710 1.04843 191 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 161 1.92420 1.31468 2.59334 0.67202 192 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 162 2.12027 2.50236 2.95043 0.29331 193 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 163 1.15676 1.74833 1.78920 1.06613 194 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 164 1.35414 2.38252 0.65224 2.05077 195 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 165 2.07146 1.30423 1.75859 0.84321 196 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.13654 4.19916 2.18370 1.46634 0.26236 1.09861 0.40547 + 166 1.52291 1.28161 1.61552 1.18565 197 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.09846 2.56219 4.09644 0.38658 1.13749 2.25173 0.11117 + 167 1.47847 1.60103 1.32052 1.19293 199 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03383 4.09644 4.09644 1.46634 0.26236 1.10756 0.40102 + 168 3.03997 2.93298 3.57129 0.13834 200 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03265 4.13141 4.13141 1.46634 0.26236 0.31688 1.30350 + 169 1.46832 1.51913 1.29487 1.28426 201 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 170 1.31570 1.45369 1.47988 1.30807 202 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 171 1.74633 1.52371 2.51390 0.64106 203 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 172 1.44976 1.88787 1.12222 1.24332 204 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 173 0.81788 1.84988 1.80362 1.44107 205 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 174 1.83311 2.01753 1.42618 0.76169 206 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.15293 2.06511 4.19916 1.04318 0.43438 1.09861 0.40547 + 175 1.43760 1.57951 1.26508 1.29387 210 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 176 1.37166 1.37577 1.35998 1.43968 211 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.11333 4.19916 2.38450 1.46634 0.26236 1.09861 0.40547 + 177 1.28494 2.08555 2.05266 0.75353 212 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03307 4.11889 4.11889 1.46634 0.26236 0.28201 1.40351 + 178 1.32626 1.58100 1.32750 1.33324 213 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 179 1.26668 1.84472 1.08732 1.50037 214 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.06354 4.19916 3.06709 1.46634 0.26236 1.09861 0.40547 + 180 0.97156 2.06784 1.14124 1.73940 215 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03148 4.16710 4.16710 1.46634 0.26236 0.49758 0.93650 + 181 2.24924 0.77646 2.19400 1.13004 216 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 182 1.17454 1.45258 1.99741 1.13511 217 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 183 1.12240 1.93625 1.89052 0.96952 218 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 184 1.46883 1.41207 1.93103 0.96451 219 u - - : + 1.38629 1.38629 1.38629 1.38629 + 0.03048 4.19916 4.19916 1.46634 0.26236 1.09861 0.40547 + 185 0.47732 2.13502 1.94810 2.13057 220 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.06354 4.19916 3.06709 1.46634 0.26236 1.09861 0.40547 + 186 0.63483 2.25268 2.03391 1.45229 221 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.01587 4.15148 * 1.46634 0.26236 0.00000 * +// +INFERNAL1/a [1.1.5 | Sep 2023] +NAME tRNA +ACC RF00005 +DESC tRNA +STATES 227 +NODES 60 +CLEN 71 +W 219 +ALPH RNA +RF no +CONS yes +MAP yes +DATE Thu Aug 1 15:47:01 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF00005/CM +PBEGIN 0.05 +PEND 0.05 +WBETA 1e-07 +QDBBETA1 1e-07 +QDBBETA2 1e-15 +N2OMEGA 1.52588e-05 +N3OMEGA 1.52588e-05 +ELSELF -0.08926734 +NSEQ 954 +EFFN 91.078789 +CKSUM 1403477983 +NULL 0.000 0.000 0.000 0.000 +GA 29.00 +TC 29.00 +NC 28.90 +EFP7GF -6.8974 0.73562 +ECMLC 0.75604 -4.48734 2.96352 1600000 335443 0.003577 +ECMGC 0.38138 -15.49460 -3.94350 1600000 32757 0.012211 +ECMLI 0.63376 -4.41829 4.19098 1600000 281040 0.004270 +ECMGI 0.41806 -11.90852 -1.42450 1600000 32030 0.012488 +CM + [ ROOT 0 ] - - - - - - + S 0 -1 0 1 4 0 1 219 415 -11.465 -12.710 -0.029 -5.694 + IL 1 1 2 1 4 13 38 221 416 -2.817 -4.319 -0.613 -2.698 0.000 0.000 0.000 0.000 + IR 2 2 3 2 3 14 40 221 416 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 1 ] - 118 - A - - + MR 3 2 3 5 5 17 43 220 415 -11.495 -0.002 -11.311 -11.523 -12.414 1.158 -1.770 -0.206 -0.717 + D 4 2 3 5 5 10 34 218 413 -3.437 -0.683 -4.505 -2.514 -3.930 + IR 5 5 3 5 5 12 37 220 415 -2.592 -0.427 -6.103 -4.271 -5.376 0.000 0.000 0.000 0.000 + [ MATP 2 ] 1 116 g c - - + MP 6 5 3 10 6 17 43 219 414 -12.516 -12.455 -0.002 -11.232 -11.511 -11.906 -5.103 -3.226 -3.882 1.492 -3.295 -4.184 0.590 -4.786 -6.286 2.999 -5.154 0.647 0.602 -5.904 -4.184 -3.379 + ML 7 5 3 10 6 10 35 216 412 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 8 5 3 10 6 11 35 216 412 -7.570 -6.299 -0.866 -6.277 -1.411 -4.491 0.172 -0.485 -0.672 0.615 + D 9 5 3 10 6 7 31 211 406 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 10 10 5 10 6 11 36 218 413 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 11 11 6 11 5 11 36 218 413 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 3 ] 2 115 g c - - + MP 12 11 6 16 6 17 42 217 412 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -6.289 -5.071 -6.292 1.528 -3.878 -5.119 2.118 -4.866 -6.371 2.406 -6.829 -0.615 1.267 -6.041 -2.653 -5.009 + ML 13 11 6 16 6 10 35 214 410 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 14 11 6 16 6 10 34 214 409 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 15 11 6 16 6 7 30 209 404 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 16 16 5 16 6 11 36 216 411 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 17 17 6 17 5 11 36 216 411 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 4 ] 3 114 g c - - + MP 18 17 6 22 6 16 40 215 410 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -3.274 -3.461 -3.369 1.579 -3.047 -4.481 1.865 -3.677 -4.121 1.967 -4.114 -0.374 1.755 -3.690 -1.262 -2.582 + ML 19 17 6 22 6 10 34 212 408 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 20 17 6 22 6 10 34 212 407 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 21 17 6 22 6 7 30 208 403 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 22 22 5 22 6 11 35 214 409 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 23 23 6 23 5 11 35 214 409 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 5 ] 4 113 g c - - + MP 24 23 6 28 6 15 38 213 408 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -1.853 -3.476 -3.635 1.643 -2.784 -3.412 1.636 -3.813 -3.363 2.116 -4.690 -0.218 1.490 -4.189 -0.531 -3.002 + ML 25 23 6 28 6 10 34 211 406 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 26 23 6 28 6 9 33 210 406 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 27 23 6 28 6 6 30 206 402 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 28 28 5 28 6 10 35 212 407 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 29 29 6 29 5 11 35 212 407 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 6 ] 5 112 a u - - + MP 30 29 6 34 6 13 36 211 406 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -3.000 -2.716 -3.318 2.151 -2.668 -3.776 1.655 -3.836 -3.622 1.587 -4.004 -0.442 1.548 -3.905 -0.554 -2.511 + ML 31 29 6 34 6 9 33 209 404 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 32 29 6 34 6 9 32 208 404 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 33 29 6 34 6 6 29 205 401 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 34 34 5 34 6 10 34 210 405 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 35 35 6 35 5 10 34 210 405 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 7 ] 6 111 u a - - + MP 36 35 6 40 6 11 34 209 404 -12.522 -12.461 -0.004 -9.375 -11.517 -11.912 -3.380 -4.285 -3.985 1.601 -2.959 -4.563 1.596 -4.238 -4.340 1.335 -4.912 -1.019 2.297 -4.421 0.090 -1.386 + ML 37 35 6 40 6 9 32 207 403 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 38 35 6 40 6 8 31 207 402 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 39 35 6 40 6 6 29 204 400 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 40 40 5 40 6 9 33 208 403 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 41 41 6 41 5 9 33 208 403 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 8 ] 7 110 g c - - + MP 42 41 6 46 4 9 32 207 402 -11.664 -9.239 -0.004 -10.285 -6.554 -4.254 -6.374 2.495 -7.484 -6.973 -0.751 -7.056 -5.027 2.585 -7.057 -0.835 1.565 -6.231 -4.566 -4.081 + ML 43 41 6 46 4 8 31 206 401 -3.916 -4.098 -0.445 -2.827 0.121 -0.374 -0.467 0.503 + MR 44 41 6 46 4 7 30 205 400 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 45 41 6 46 4 6 29 204 399 -4.568 -4.250 -2.265 -0.520 + IL 46 46 5 46 4 8 31 207 402 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 47 47 6 47 3 8 31 206 402 -1.551 -0.722 -4.251 0.000 0.000 0.000 0.000 + [ MATL 9 ] 8 - U - - - + ML 48 47 6 50 3 7 30 205 400 -7.517 -0.021 -6.788 -1.850 -4.362 -2.876 1.823 + D 49 47 6 50 3 5 28 203 399 -6.174 -1.687 -0.566 + IL 50 50 3 50 3 7 30 205 401 -1.822 -0.570 -4.522 0.000 0.000 0.000 0.000 + [ MATL 10 ] 10 - A - - - + ML 51 50 3 53 2 6 29 204 399 -7.401 -0.009 1.405 -2.598 0.104 -3.161 + D 52 50 3 53 2 5 28 203 398 -8.606 -0.004 + IL 53 53 3 53 2 6 29 204 399 -2.472 -0.287 0.000 0.000 0.000 0.000 + [ BIF 11 ] - - - - - - + B 54 53 3 121 55 5 28 203 398 + [ BEGR 42 ] - - - - - - + S 55 54 1 56 3 0 2 169 365 -12.579 -0.001 -11.233 + IL 56 56 2 56 3 1 3 174 369 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 43 ] 55 - A - - - + ML 57 56 2 59 3 1 2 169 365 -12.579 -0.186 -3.050 1.008 -0.981 -1.233 0.080 + D 58 56 2 59 3 0 0 185 381 -6.174 -1.687 -0.566 + IL 59 59 3 59 3 1 2 167 363 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 44 ] 56 - g - - - + ML 60 59 3 62 3 1 1 148 344 -5.854 -0.036 -7.030 0.207 -2.526 0.991 -0.547 + D 61 59 3 62 3 0 0 189 385 -0.113 -4.285 -5.387 + IL 62 62 3 62 3 1 1 190 386 -0.136 -3.933 -5.352 0.000 0.000 0.000 0.000 + [ MATL 45 ] 81 - g - - - + ML 63 62 3 65 3 1 1 31 49 -1.153 -0.867 -8.913 0.681 -2.760 0.753 -0.829 + D 64 62 3 65 3 0 0 29 47 -5.768 -0.121 -4.016 + IL 65 65 3 65 3 1 1 30 48 -5.294 -0.040 -8.831 0.000 0.000 0.000 0.000 + [ MATL 46 ] 85 - c - - - + ML 66 65 3 68 5 1 1 29 47 -11.518 -0.002 -11.334 -11.546 -12.438 -1.629 0.852 -3.264 0.821 + D 67 65 3 68 5 0 0 28 46 -5.223 -0.634 -4.484 -2.859 -2.771 + IL 68 68 3 68 5 1 1 30 48 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 47 ] 86 108 g c - - + MP 69 68 3 73 6 2 2 28 46 -12.522 -8.639 -0.005 -11.237 -11.517 -11.912 -3.301 -4.666 -6.055 2.145 -4.292 -6.716 1.033 -6.622 -6.379 2.593 -6.722 0.754 0.224 -3.146 -2.245 -3.822 + ML 70 68 3 73 6 1 1 27 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 71 68 3 73 6 1 1 27 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 72 68 3 73 6 0 0 25 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 73 73 5 73 6 1 1 28 46 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 74 74 6 74 5 1 1 28 46 -2.608 -0.422 -6.119 -4.286 -5.392 0.000 0.000 0.000 0.000 + [ MATP 48 ] 87 106 c g - - + MP 75 74 6 79 6 2 2 26 44 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -4.977 -4.080 -5.139 1.658 -4.013 -5.988 2.091 -5.296 -5.167 1.273 -5.726 -0.309 2.042 -4.032 -0.625 -1.915 + ML 76 74 6 79 6 1 1 25 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 77 74 6 79 6 1 1 25 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 78 74 6 79 6 0 0 23 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 79 79 5 79 6 1 1 26 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 80 80 6 80 5 1 1 26 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 49 ] 88 105 g c - - + MP 81 80 6 85 6 2 2 24 42 -6.731 -12.461 -0.020 -11.237 -11.517 -8.100 -5.866 -3.047 -5.860 2.261 -6.202 -6.569 1.094 -5.361 -5.273 2.456 -5.407 -0.909 1.196 -5.843 -1.695 -2.480 + ML 82 80 6 85 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 83 80 6 85 6 1 1 24 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 84 80 6 85 6 0 0 22 40 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 85 85 5 85 6 1 1 24 42 -3.556 -3.818 -0.337 -5.474 -6.250 -5.910 0.000 0.000 0.000 0.000 + IR 86 86 6 86 5 1 1 24 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 50 ] 90 104 G C - - + MP 87 86 6 91 6 2 2 22 40 -12.517 -12.456 -0.101 -8.260 -11.512 -3.973 -6.543 -2.221 -6.362 1.709 -4.066 -6.958 -0.839 -5.218 -4.331 3.354 -7.046 -1.448 -0.037 -6.216 -2.717 -4.292 + ML 88 86 6 91 6 1 1 24 42 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 89 86 6 91 6 1 1 24 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 90 86 6 91 6 0 0 21 39 -9.737 -8.435 -4.232 -4.914 -4.932 -0.190 + IL 91 91 5 91 6 1 1 23 41 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 92 92 6 92 5 1 1 23 41 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 51 ] 91 103 G C - - + MP 93 92 6 97 4 2 2 20 38 -11.556 -11.763 -0.045 -5.062 -6.450 -2.247 -6.268 0.143 -1.754 -3.741 -2.188 -4.234 -6.706 3.712 -4.967 -2.075 -1.352 -3.328 -3.163 -5.233 + ML 94 92 6 97 4 1 1 23 42 -4.136 -4.318 -0.373 -3.048 -0.092 0.515 -0.796 0.081 + MR 95 92 6 97 4 1 1 23 41 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 96 92 6 97 4 0 0 20 38 -8.181 -7.863 -0.744 -1.339 + IL 97 97 5 97 4 1 1 25 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 98 98 6 98 3 1 1 24 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 52 ] 92 - U - - - + ML 99 98 6 101 3 1 1 18 35 -9.047 -0.003 -11.155 -1.552 -2.232 -3.349 1.743 + D 100 98 6 101 3 0 0 17 34 -9.871 -0.107 -3.834 + IL 101 101 3 101 3 1 1 21 39 -1.570 -0.710 -4.270 0.000 0.000 0.000 0.000 + [ MATL 53 ] 94 - U - - - + ML 102 101 3 104 3 1 1 17 34 -12.578 -0.003 -9.088 -1.976 -2.502 -1.896 1.723 + D 103 101 3 104 3 0 0 17 36 -6.477 -1.180 -0.869 + IL 104 104 3 104 3 1 1 22 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 54 ] 95 - C - - - + ML 105 104 3 107 3 1 1 16 32 -12.577 -0.002 -9.444 -0.680 1.485 -3.054 -1.132 + D 106 104 3 107 3 0 0 16 35 -6.577 -2.090 -0.406 + IL 107 107 3 107 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 55 ] 96 - g - - - + ML 108 107 3 110 3 1 1 15 31 -7.189 -0.019 -7.356 0.786 -2.076 0.835 -1.967 + D 109 107 3 110 3 0 0 14 31 -6.809 -0.847 -1.201 + IL 110 110 3 110 3 1 1 16 32 -1.906 -0.531 -4.606 0.000 0.000 0.000 0.000 + [ MATL 56 ] 98 - A - - - + ML 111 110 3 113 3 1 1 13 30 -12.571 -0.061 -4.606 1.799 -2.498 -3.322 -2.039 + D 112 110 3 113 3 0 0 14 32 -7.367 -2.880 -0.221 + IL 113 113 3 113 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 57 ] 99 - a - - - + ML 114 113 3 116 3 1 1 12 27 -5.730 -0.171 -3.430 0.838 -1.131 -0.452 0.036 + D 115 113 3 116 3 0 0 12 27 -4.693 -3.994 -0.154 + IL 116 116 3 116 3 1 1 15 29 -1.784 -0.542 -5.447 0.000 0.000 0.000 0.000 + [ MATL 58 ] 102 - U - - - + ML 117 116 3 119 2 1 1 1 1 * 0.000 -1.852 -0.731 -3.750 1.607 + D 118 116 3 119 2 0 0 0 0 * 0.000 + IL 119 119 3 119 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 59 ] - - - - - - + E 120 119 3 -1 0 0 0 0 0 + [ BEGL 12 ] - - - - - - + S 121 54 1 122 1 0 9 46 64 0.000 + [ BIF 13 ] - - - - - - + B 122 121 1 123 170 0 9 46 64 + [ BEGL 14 ] - - - - - - + S 123 122 1 124 4 0 0 28 46 -0.003 -10.619 -10.026 -10.666 + [ MATP 15 ] 12 32 G C - - + MP 124 123 1 128 6 2 2 28 46 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -6.548 -4.498 -3.194 0.546 -7.496 -6.962 -0.499 -4.429 -3.839 3.434 -4.677 0.994 -0.870 -6.221 -3.527 -4.149 + ML 125 123 1 128 6 1 1 27 45 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 126 123 1 128 6 1 1 27 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 127 123 1 128 6 0 0 25 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 128 128 5 128 6 1 1 28 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 129 129 6 129 5 1 1 27 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 16 ] 13 31 C G - - + MP 130 129 6 134 6 2 2 26 44 -12.522 -12.461 -0.003 -9.627 -11.517 -11.912 -6.838 -4.852 -5.490 -0.500 -5.716 -7.685 3.072 -6.367 -6.701 0.300 -7.215 -3.663 2.325 -3.620 -1.660 -4.451 + ML 131 129 6 134 6 1 1 26 44 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 132 129 6 134 6 1 1 26 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 133 129 6 134 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 134 134 5 134 6 1 1 26 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 135 135 6 135 5 1 1 26 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 17 ] 14 30 u a - - + MP 136 135 6 140 6 2 2 24 42 -12.520 -12.460 -0.002 -11.236 -11.516 -11.911 -3.635 -4.663 -6.518 0.940 -3.362 -7.363 1.608 -6.200 -4.889 1.434 -6.950 -3.749 2.921 -6.689 -1.498 -5.235 + ML 137 135 6 140 6 1 1 25 44 -6.414 -6.760 -1.097 -1.169 -6.610 -4.140 0.174 0.072 -0.497 0.153 + MR 138 135 6 140 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 139 135 6 140 6 0 0 24 42 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 140 140 5 140 6 1 1 25 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 141 141 6 141 5 1 1 24 43 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 18 ] 15 29 u a - - + MP 142 141 6 146 4 2 2 22 39 -11.666 -11.873 -0.006 -8.087 0.494 -2.849 -2.130 0.057 -2.821 -3.668 1.962 -4.057 0.656 -0.751 -3.003 -1.297 1.964 -3.215 0.719 -0.617 + ML 143 141 6 146 4 1 1 25 44 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 144 141 6 146 4 1 1 24 43 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 145 141 6 146 4 0 0 24 42 -4.568 -4.250 -2.265 -0.520 + IL 146 146 5 146 4 1 1 26 45 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 147 147 6 147 3 1 1 25 44 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 19 ] 16 - A - - - + ML 148 147 6 150 3 1 1 19 36 -12.575 -0.020 -6.166 1.868 -4.416 -2.946 -2.521 + D 149 147 6 150 3 0 0 20 38 -6.897 -2.410 -0.316 + IL 150 150 3 150 3 1 1 24 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 20 ] 17 - a - - - + ML 151 150 3 153 3 1 1 18 35 -12.556 -0.291 -2.453 0.801 -2.961 0.782 -1.285 + D 152 150 3 153 3 0 0 18 36 -8.407 -3.920 -0.103 + IL 153 153 3 153 3 1 1 23 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 21 ] 18 - U - - - + ML 154 153 3 156 3 1 1 17 34 -1.261 -0.881 -4.654 -0.641 -0.352 -2.375 1.253 + D 155 153 3 156 3 0 0 15 32 -11.676 -0.275 -2.529 + IL 156 156 3 156 3 1 1 17 34 -2.362 -0.373 -4.902 0.000 0.000 0.000 0.000 + [ MATL 22 ] 22 - G - - - + ML 157 156 3 159 3 1 1 15 32 -12.464 -0.001 -11.118 -0.824 -2.248 1.555 -1.807 + D 158 156 3 159 3 0 0 14 32 -10.373 -5.886 -0.026 + IL 159 159 3 159 3 1 1 20 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 23 ] 23 - G - - - + ML 160 159 3 162 3 1 1 14 30 -12.464 -0.316 -2.349 -1.669 -2.078 1.563 -1.017 + D 161 159 3 162 3 0 0 13 31 -10.373 -5.886 -0.026 + IL 162 162 3 162 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 24 ] 24 - U - - - + ML 163 162 3 165 3 1 1 13 26 -1.101 -0.911 -9.182 -1.400 -0.983 -2.589 1.560 + D 164 162 3 165 3 0 0 9 21 -8.236 -0.039 -5.429 + IL 165 165 3 165 3 1 1 13 25 -2.109 -0.404 -6.354 0.000 0.000 0.000 0.000 + [ MATL 25 ] 28 - A - - - + ML 166 165 3 168 2 1 1 1 1 * 0.000 1.749 -3.071 -1.968 -1.927 + D 167 165 3 168 2 0 0 0 0 * 0.000 + IL 168 168 3 168 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 26 ] - - - - - - + E 169 168 3 -1 0 0 0 0 0 + [ BEGR 27 ] - - - - - - + S 170 122 1 171 3 0 0 29 47 -12.579 -0.005 -8.226 + IL 171 171 2 171 3 1 1 35 53 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 28 ] 33 - a - - - + ML 172 171 2 174 5 1 1 29 47 -7.337 -0.012 -9.422 -11.544 -12.436 0.903 -2.506 0.636 -1.318 + D 173 171 2 174 5 0 0 28 46 -5.417 -0.537 -4.678 -3.053 -2.966 + IL 174 174 3 174 5 1 1 29 47 -2.843 -0.350 -4.522 -6.354 -5.628 0.000 0.000 0.000 0.000 + [ MATP 29 ] 35 54 u a - - + MP 175 174 3 179 6 2 2 28 46 -9.564 -9.206 -0.006 -11.236 -11.516 -11.911 -2.035 -3.046 -3.177 1.353 -1.905 -3.759 2.011 -1.955 -3.083 0.079 -4.677 0.002 2.289 -2.363 -0.486 -1.588 + ML 176 174 3 179 6 1 1 27 45 -6.444 -6.790 -1.064 -1.199 -6.640 -4.169 0.146 0.124 -0.531 0.153 + MR 177 174 3 179 6 1 1 26 45 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 178 174 3 179 6 0 0 24 43 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 179 179 5 179 6 1 1 27 46 -2.743 -3.006 -0.657 -4.661 -5.437 -5.098 0.000 0.000 0.000 0.000 + IR 180 180 6 180 5 1 1 27 45 -2.541 -0.445 -6.052 -4.220 -5.326 0.000 0.000 0.000 0.000 + [ MATP 30 ] 37 52 u a - - + MP 181 180 6 185 6 2 2 26 44 -12.522 -12.461 -0.002 -11.237 -11.517 -11.912 -5.944 -5.896 -6.047 1.384 -5.369 -4.198 2.371 -3.446 -6.006 0.556 -6.547 -1.326 2.408 -6.208 -0.862 -2.110 + ML 182 180 6 185 6 1 1 25 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 183 180 6 185 6 1 1 25 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 184 180 6 185 6 0 0 23 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 185 185 5 185 6 1 1 26 44 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 186 186 6 186 5 1 1 25 44 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 31 ] 38 51 g c - - + MP 187 186 6 191 6 2 2 24 42 -12.522 -12.461 -0.004 -11.237 -9.372 -11.912 -4.443 -2.637 -5.765 2.061 -4.395 -3.756 0.872 -6.144 -5.960 2.413 -6.398 -2.342 1.953 -5.778 -3.331 -3.387 + ML 188 186 6 191 6 1 1 24 43 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 189 186 6 191 6 1 1 24 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 190 186 6 191 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 191 191 5 191 6 1 1 24 42 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 192 192 6 192 5 1 1 24 42 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 32 ] 39 50 G C - - + MP 193 192 6 197 6 2 2 22 40 -12.520 -12.459 -0.003 -11.236 -9.691 -11.911 -4.938 -3.976 -6.364 1.149 -5.795 -6.963 1.460 -5.242 -6.793 3.187 -7.045 -0.144 -1.015 -6.223 -2.278 -2.995 + ML 194 192 6 197 6 1 1 24 42 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 195 192 6 197 6 1 1 23 42 -7.181 -5.910 -1.289 -5.889 -1.022 -4.102 0.109 -0.376 -0.481 0.521 + D 196 192 6 197 6 0 0 22 41 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 197 197 5 197 6 1 1 23 41 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 198 198 6 198 5 1 1 22 41 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 33 ] 40 49 a u - - + MP 199 198 6 203 4 2 2 20 38 -11.665 -11.872 -0.002 -10.286 -3.145 -3.157 -3.826 2.358 -3.768 -4.916 1.782 -4.414 -3.697 1.653 -3.735 -1.271 1.143 -3.465 -0.478 -1.970 + ML 200 198 6 203 4 1 1 23 42 -3.758 -3.940 -0.507 -2.670 0.368 -0.385 -0.191 0.094 + MR 201 198 6 203 4 1 1 23 41 -4.977 -4.006 -1.386 -0.934 0.171 0.078 -0.501 0.153 + D 202 198 6 203 4 0 0 22 40 -4.568 -4.250 -2.265 -0.520 + IL 203 203 5 203 4 1 1 25 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 204 204 6 204 3 1 1 24 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 34 ] 41 - C - - - + ML 205 204 6 207 3 1 1 17 35 -8.653 -0.004 -11.233 -2.949 1.185 -4.211 0.625 + D 206 204 6 207 3 0 0 18 36 -6.174 -1.687 -0.566 + IL 207 207 3 207 3 1 1 21 38 -1.621 -0.679 -4.321 0.000 0.000 0.000 0.000 + [ MATL 35 ] 43 - U - - - + ML 208 207 3 210 3 1 1 15 34 -12.579 -0.001 -11.233 -6.848 -2.867 -7.612 1.945 + D 209 207 3 210 3 0 0 18 36 -6.174 -1.687 -0.566 + IL 210 210 3 210 3 1 1 22 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 36 ] 44 - u - - - + ML 211 210 3 213 3 1 1 14 33 -12.579 -0.001 -11.233 -1.942 -0.673 0.371 0.863 + D 212 210 3 213 3 0 0 17 35 -6.174 -1.687 -0.566 + IL 213 213 3 213 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 37 ] 45 - a - - - + ML 214 213 3 216 3 1 1 13 31 -12.579 -0.001 -11.233 0.339 -0.296 -0.448 0.247 + D 215 213 3 216 3 0 0 16 34 -6.174 -1.687 -0.566 + IL 216 216 3 216 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 38 ] 46 - u - - - + ML 217 216 3 219 3 1 1 12 30 -12.579 -0.001 -11.233 0.117 -0.061 -0.283 0.183 + D 218 216 3 219 3 0 0 15 33 -6.174 -1.687 -0.566 + IL 219 219 3 219 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 39 ] 47 - A - - - + ML 220 219 3 222 3 1 1 10 28 -12.579 -0.001 -11.233 1.631 -5.002 -0.290 -4.241 + D 221 219 3 222 3 0 0 13 32 -6.174 -1.687 -0.566 + IL 222 222 3 222 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 40 ] 48 - A - - - + ML 223 222 3 225 2 1 1 1 1 * 0.000 1.380 -0.448 -2.596 -1.002 + D 224 222 3 225 2 0 0 0 0 * 0.000 + IL 225 225 3 225 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 41 ] - - - - - - + E 226 225 3 -1 0 0 0 0 0 +// +HMMER3/f [3.4 | Aug 2023] +NAME tRNA +ACC RF00005 +DESC tRNA +LENG 71 +MAXL 217 +ALPH RNA +RF no +MM no +CONS yes +CS yes +MAP yes +DATE Thu Aug 1 15:47:01 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF00005/CM +NSEQ 954 +EFFN 617.091797 +CKSUM 1403477983 +STATS LOCAL MSV -9.0088 0.73562 +STATS LOCAL VITERBI -9.5816 0.73562 +STATS LOCAL FORWARD -2.6284 0.73562 +HMM A C G U + m->m m->i m->d i->m i->i d->m d->d + COMPO 1.32305 1.55814 1.36744 1.31531 + 1.38629 1.38629 1.38629 1.38629 + 0.00457 9.16555 5.41350 1.46634 0.26236 0.00000 * + 1 1.68320 2.26022 0.49585 2.29423 1 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16119 9.16119 1.46634 0.26236 0.04587 3.10477 + 2 1.68837 1.26489 0.97095 1.86960 2 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 3 1.60273 1.41423 1.16388 1.41359 3 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 4 1.50208 1.56604 1.04572 1.52775 4 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 5 1.15807 1.55504 1.40411 1.47341 5 a - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 6 1.60732 1.63382 1.66590 0.87858 6 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 7 0.98761 3.45981 0.92659 1.60845 7 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 8 2.68037 4.97023 3.41200 0.11480 8 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01450 5.20358 4.72204 0.03763 3.29881 1.09861 0.40547 + 9 0.40974 3.25749 1.29393 3.75075 10 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.00611 5.11896 9.15672 0.03491 3.37244 0.02324 3.77360 + 10 2.41177 3.17187 0.18307 3.33245 12 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 11 3.22143 0.60792 2.61661 1.07128 13 C - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 12 2.06930 1.68722 1.74703 0.66475 14 U - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 13 1.78843 1.33019 1.83996 0.89276 15 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00313 9.16555 5.80099 1.46634 0.26236 1.09861 0.40547 + 14 0.08151 4.91756 3.50648 3.19514 16 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01406 9.16263 4.27899 1.46634 0.26236 3.43143 0.03288 + 15 0.81072 3.67104 0.83591 2.33785 17 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.20553 9.14878 1.68374 1.46634 0.26236 5.08779 0.00619 + 16 1.87367 1.63365 3.22952 0.49160 18 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.60015 0.88905 3.21325 0.21173 1.65642 0.17761 1.81564 + 17 1.97297 2.99761 0.29666 2.69193 22 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01491 9.09903 4.22053 1.46634 0.26236 6.42709 0.00162 + 18 2.63640 2.86665 0.29060 2.09011 23 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.22194 9.08434 1.61485 1.46634 0.26236 6.61848 0.00134 + 19 2.39888 2.07296 3.27752 0.29351 24 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.63864 0.75362 6.62210 0.26095 1.47108 0.01293 4.35429 + 20 0.16448 3.66191 2.76851 2.76099 28 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16151 9.16151 1.46634 0.26236 0.04933 3.03369 + 21 0.74875 3.37810 0.96619 2.18568 29 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00113 9.16555 6.88643 1.46634 0.26236 1.09861 0.40547 + 22 0.67591 1.75284 1.62542 2.11035 30 A - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16463 9.16463 1.46634 0.26236 0.18627 1.77225 + 23 1.13652 2.55441 0.57919 3.19469 31 G - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 24 3.37843 0.35926 2.96299 1.53229 32 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00319 9.16555 5.78186 1.46634 0.26236 1.09861 0.40547 + 25 0.74100 3.29089 0.93165 2.38336 33 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.00621 5.10110 9.16257 0.03410 3.39551 0.06564 2.75619 + 26 1.69922 1.21087 2.09501 0.92592 35 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00145 6.61258 9.16555 0.14903 1.97722 1.09861 0.40547 + 27 1.79075 1.09275 2.20574 0.94751 37 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 28 1.26180 2.14608 1.08547 1.33876 38 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00147 9.16555 6.59822 1.46634 0.26236 1.09861 0.40547 + 29 1.97749 1.70048 0.45552 3.10395 39 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00115 9.16429 6.86776 1.46634 0.26236 0.14278 2.01697 + 30 1.02606 1.50707 1.45802 1.67490 40 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16462 9.16462 1.46634 0.26236 0.18333 1.78672 + 31 3.66593 0.55444 4.58501 0.94206 41 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00258 6.00456 9.16555 0.08271 2.53345 1.09861 0.40547 + 32 9.03936 3.42316 9.68124 0.03334 43 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 33 3.01213 1.86968 1.09843 0.76949 44 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 34 1.14887 1.58629 1.69807 1.21981 45 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 35 1.31624 1.41244 1.57465 1.26859 46 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 36 0.25014 5.29580 1.58084 4.55733 47 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 37 0.41515 1.68547 3.34145 2.12853 48 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 38 1.97140 1.53803 1.33374 0.96117 49 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 39 3.55579 0.54128 1.65014 1.62246 50 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 40 1.34736 1.06316 2.18599 1.26462 51 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 41 1.06865 2.40716 1.02891 1.56513 52 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00294 6.35620 6.72767 0.11642 2.20823 1.09861 0.40547 + 42 1.01581 2.62115 1.18065 1.35443 54 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16446 9.16446 1.46634 0.26236 0.16100 1.90574 + 43 0.65860 2.10704 2.30317 1.34368 55 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.00534 9.16555 5.25470 1.46634 0.26236 1.09861 0.40547 + 44 1.23131 3.35069 0.68157 1.78853 56 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.15091 2.01361 5.02555 2.37507 0.09762 0.03927 3.25697 + 45 0.89322 3.55739 0.84875 2.00840 81 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.58548 0.81769 6.36952 0.01221 4.41195 0.03151 3.47323 + 46 2.58263 0.79056 3.79832 0.80201 85 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16395 9.16395 1.46634 0.26236 0.11591 2.21234 + 47 1.22230 2.01648 0.73392 2.38270 86 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 48 1.57738 1.30482 1.59384 1.14219 87 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 49 1.13610 2.00665 0.99469 1.74495 88 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01392 4.59858 5.58529 0.02065 3.89031 1.09861 0.40547 + 50 1.51401 3.38067 0.39084 2.66698 90 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.07105 9.16190 2.68125 1.46634 0.26236 3.63450 0.02675 + 51 2.67627 3.34137 0.14430 3.50124 91 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03013 9.09107 3.52094 1.46634 0.26236 0.46159 0.99501 + 52 2.46534 2.99105 3.79939 0.17150 92 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00197 6.28635 9.11026 0.11479 2.22152 0.02357 3.75942 + 53 2.79003 3.20451 2.69065 0.18613 94 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00166 9.16450 6.46776 1.46634 0.26236 0.16633 1.87578 + 54 1.85636 0.33827 3.60222 2.26824 95 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.00125 9.16410 6.77369 1.46634 0.26236 2.82324 0.06125 + 55 0.82101 2.89700 0.80173 2.87762 96 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01290 4.97393 5.13339 0.03005 3.51995 0.07771 2.59336 + 56 0.12950 3.19137 3.81433 2.84221 98 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.04047 9.15976 3.23013 1.46634 0.26236 4.06462 0.01732 + 57 0.77980 2.23009 1.70172 1.37987 99 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.12003 3.95820 2.36438 0.30392 1.33912 3.15262 0.04368 + 58 2.70432 1.88022 4.17283 0.26772 102 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.02979 9.02302 3.53252 1.46634 0.26236 0.46834 0.98361 + 59 3.24380 0.12480 4.45774 2.70716 103 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00023 9.08778 9.08778 1.46634 0.26236 0.05270 2.96942 + 60 2.71709 0.40063 3.29765 1.48252 104 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16190 9.16190 1.46634 0.26236 0.05424 2.94136 + 61 1.91099 1.06251 1.88568 1.03633 105 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 62 1.32041 1.85221 1.18506 1.30800 106 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00272 5.94615 9.16555 0.07812 2.58826 1.09861 0.40547 + 63 2.52339 0.97066 1.95493 0.91778 108 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.00280 6.49444 6.65956 0.13303 2.08294 1.09861 0.40547 + 64 1.61805 1.00437 3.45056 0.90705 110 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16437 9.16437 1.46634 0.26236 0.15117 1.96401 + 65 1.08823 1.81448 1.37075 1.40100 111 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 66 1.61587 1.56786 1.42286 1.04479 112 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 67 1.60069 1.19749 1.44535 1.34467 113 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 68 1.48720 1.31348 1.35791 1.39467 114 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 69 1.88414 1.07419 1.26922 1.48981 115 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.00021 9.16555 9.16555 1.46634 0.26236 1.09861 0.40547 + 70 2.26777 0.66483 2.32014 1.25935 116 C - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01594 9.16555 4.15353 1.46634 0.26236 1.09861 0.40547 + 71 0.55707 2.72888 1.51490 1.95199 118 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.00011 9.14972 * 1.46634 0.26236 0.00000 * +// +INFERNAL1/a [1.1.5 | Sep 2023] +NAME tmRNA +ACC RF00023 +DESC transfer-messenger RNA +STATES 1151 +NODES 302 +CLEN 374 +W 546 +ALPH RNA +RF no +CONS yes +MAP yes +DATE Tue Aug 6 09:53:22 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF00023/CM +PBEGIN 0.05 +PEND 0.05 +WBETA 1e-07 +QDBBETA1 1e-07 +QDBBETA2 1e-15 +N2OMEGA 1.52588e-05 +N3OMEGA 1.52588e-05 +ELSELF -0.08926734 +NSEQ 477 +EFFN 35.274971 +CKSUM 1194545277 +NULL 0.000 0.000 0.000 0.000 +GA 47.00 +TC 47.10 +NC 46.90 +EFP7GF -20.4847 0.70340 +ECMLC 0.91791 -8.82961 -1.95115 1600000 662562 0.001811 +ECMGC 0.25944 -60.69122 -50.72260 1600000 5312 0.075301 +ECMLI 0.97281 -7.39515 -1.19173 1600000 501226 0.002394 +ECMGI 0.27200 -29.60397 -20.13108 1600000 5261 0.076031 +CM + [ ROOT 0 ] - - - - - - + S 0 -1 0 1 4 1 1 546 744 -10.142 -11.388 -0.209 -2.907 + IL 1 1 2 1 4 162 235 547 745 -2.817 -4.319 -0.613 -2.698 0.000 0.000 0.000 0.000 + IR 2 2 3 2 3 164 237 547 746 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 1 ] - 954 - A - - + MR 3 2 3 5 3 164 237 547 745 -11.361 -0.173 -3.147 1.333 -1.590 -0.919 -0.692 + D 4 2 3 5 3 157 227 537 735 -9.830 -5.007 -0.047 + IR 5 5 3 5 3 166 239 547 745 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 2 ] - 953 - C - - + MR 6 5 3 8 3 172 243 546 744 -11.190 -0.003 -9.508 -0.932 1.336 -2.627 -0.341 + D 7 5 3 8 3 157 227 537 735 -10.586 -4.445 -0.069 + IR 8 8 3 8 3 166 239 546 744 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 3 ] - 952 - C - - + MR 9 8 3 11 3 171 242 545 743 -11.202 -0.003 -9.520 -2.734 1.552 -3.661 -0.254 + D 10 8 3 11 3 157 227 536 734 -10.546 -2.293 -0.330 + IR 11 11 3 11 3 165 238 545 743 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 4 ] - 951 - A - - + MR 12 11 3 14 5 171 241 544 742 -9.933 -0.026 -9.748 -6.062 -10.852 1.989 -7.068 -6.400 -6.569 + D 13 11 3 14 5 156 226 532 730 -8.453 -3.808 -4.598 -7.510 -0.186 + IR 14 14 3 14 5 166 238 544 742 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 5 ] 1 950 G C - - + MP 15 14 3 19 6 170 240 543 741 -11.053 -10.993 -0.005 -9.769 -10.049 -10.444 -8.895 -5.623 -10.815 -3.059 -10.483 -6.814 -4.881 -10.417 -6.984 3.970 -7.186 -3.538 -5.246 -7.268 -7.298 -9.748 + ML 16 14 3 19 6 163 234 540 738 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.114 -0.763 0.563 -0.232 + MR 17 14 3 19 6 163 234 540 738 -7.614 -6.343 -2.252 -6.321 -0.480 -4.535 -0.258 0.737 -0.978 -0.016 + D 18 14 3 19 6 155 225 529 727 -12.718 -11.416 -7.213 -7.896 -7.913 -0.023 + IL 19 19 5 19 6 165 237 542 740 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 20 20 6 20 5 166 237 542 740 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 6 ] 2 949 G C - - + MP 21 20 6 25 6 168 238 541 739 -11.053 -10.993 -0.005 -9.769 -10.049 -10.444 -8.895 -5.623 -10.815 -3.059 -10.483 -6.814 -4.881 -10.417 -6.984 3.970 -7.186 -3.538 -5.246 -7.268 -7.298 -9.748 + ML 22 20 6 25 6 163 233 538 737 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.114 -0.763 0.563 -0.232 + MR 23 20 6 25 6 162 233 538 736 -7.614 -6.343 -1.845 -6.321 -0.625 -4.535 -0.258 0.737 -0.978 -0.016 + D 24 20 6 25 6 155 225 529 727 -12.718 -11.416 -7.213 -5.721 -7.913 -0.044 + IL 25 25 5 25 6 165 236 540 738 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 26 26 6 26 5 165 236 540 738 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 7 ] 3 948 G U - - + MP 27 26 6 31 6 167 236 539 737 -11.057 -10.996 -0.005 -9.773 -10.052 -10.447 -6.873 -5.546 -7.052 -1.858 -8.792 -10.088 -4.312 -7.069 -6.623 -2.205 -7.281 3.936 -4.424 -8.331 -6.178 -5.657 + ML 28 26 6 31 6 162 232 537 735 -6.768 -7.114 -1.379 -0.871 -6.964 -4.494 -0.008 -0.902 0.750 -0.344 + MR 29 26 6 31 6 161 231 536 734 -7.512 -6.241 -2.150 -6.219 -0.522 -4.433 -0.199 -0.504 -0.820 0.893 + D 30 26 6 31 6 155 225 529 727 -12.697 -11.395 -6.211 -7.874 -7.892 -0.033 + IL 31 31 5 31 6 164 234 538 736 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 32 32 6 32 5 164 234 538 736 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 8 ] 4 947 G C - - + MP 33 32 6 37 6 165 234 537 735 -11.063 -11.002 -0.005 -9.779 -10.058 -10.453 -8.450 -5.576 -9.387 -1.813 -9.641 -6.846 -3.071 -9.400 -6.928 3.927 -7.153 -3.439 -2.156 -7.197 -6.690 -8.255 + ML 34 32 6 37 6 161 231 535 733 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.114 -0.763 0.563 -0.232 + MR 35 32 6 37 6 160 230 534 732 -7.512 -6.241 -2.150 -6.219 -0.522 -4.433 -0.170 0.624 -0.882 0.038 + D 36 32 6 37 6 155 225 528 726 -12.687 -11.385 -7.182 -7.864 -7.882 -0.023 + IL 37 37 5 37 6 162 233 536 734 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 38 38 6 38 5 163 233 536 734 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 9 ] 5 946 g c - - + MP 39 38 6 43 6 163 232 535 733 -11.063 -11.002 -0.005 -9.779 -10.058 -10.453 -5.227 -4.325 -5.147 1.677 -4.910 -5.853 2.189 -5.242 -5.304 2.524 -5.697 -1.549 0.004 -5.143 -0.272 -3.966 + ML 40 38 6 43 6 160 230 533 731 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.114 -0.763 0.563 -0.232 + MR 41 38 6 43 6 159 229 532 731 -7.512 -6.241 -2.150 -6.219 -0.522 -4.433 0.022 -0.225 -0.434 0.474 + D 42 38 6 43 6 155 225 528 726 -12.687 -11.385 -7.182 -7.864 -7.882 -0.023 + IL 43 43 5 43 6 161 231 534 733 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 44 44 6 44 5 161 231 534 732 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 10 ] 6 945 u a - - + MP 45 44 6 49 6 161 230 533 731 -11.063 -11.002 -0.005 -9.779 -10.058 -10.453 -7.107 -7.063 -6.733 -1.774 -5.266 -7.114 2.868 -6.094 -6.735 -2.394 -7.013 -4.902 2.963 -7.110 -1.889 -5.501 + ML 46 44 6 49 6 159 228 532 730 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.005 0.366 -0.690 0.122 + MR 47 44 6 49 6 158 227 531 729 -7.512 -6.241 -2.150 -6.219 -0.948 -2.159 0.071 -0.010 -0.144 0.072 + D 48 44 6 49 6 155 225 528 726 -12.687 -11.385 -7.182 -5.935 -7.882 -0.041 + IL 49 49 5 49 6 160 229 533 731 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 50 50 6 50 5 159 229 532 730 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 11 ] 7 944 G C - - + MP 51 50 6 55 4 159 228 531 729 -10.043 -7.438 -0.040 -5.577 -8.839 -5.633 -10.529 -3.045 -10.265 -6.836 -4.799 -10.188 -6.987 3.961 -7.195 -3.539 -3.108 -7.281 -7.177 -9.422 + ML 52 50 6 55 4 157 227 530 728 -4.137 -4.319 -0.505 -2.408 0.338 -0.768 0.360 -0.208 + MR 53 50 6 55 4 157 226 530 728 -5.085 -4.114 -1.981 -0.601 0.074 0.250 -0.613 0.142 + D 54 50 6 55 4 155 225 528 726 -8.143 -7.824 -5.840 -0.037 + IL 55 55 5 55 4 158 228 531 729 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 56 56 6 56 3 158 228 531 729 -1.568 -0.711 -4.268 0.000 0.000 0.000 0.000 + [ MATL 12 ] 8 - A - - - + ML 57 56 6 59 3 157 226 529 728 -10.948 -0.564 -1.631 1.101 -1.421 -2.832 0.423 + D 58 56 6 59 3 155 225 528 726 -10.378 -1.290 -0.761 + IL 59 59 3 59 3 158 228 530 728 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 13 ] 9 - u - - - + ML 60 59 3 62 3 157 226 529 727 -1.664 -0.831 -3.032 -0.235 -0.308 -1.151 0.920 + D 61 59 3 62 3 154 224 527 725 -1.184 -1.789 -1.886 + IL 62 62 3 62 3 159 228 529 727 -4.482 -0.075 -7.371 0.000 0.000 0.000 0.000 + [ MATL 14 ] 12 - c - - - + ML 63 62 3 65 3 158 227 528 726 -10.984 -0.013 -6.937 0.338 0.433 -2.171 0.219 + D 64 62 3 65 3 151 220 522 720 -10.225 -5.738 -0.029 + IL 65 65 3 65 3 157 226 528 727 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 15 ] 13 - u - - - + ML 66 65 3 68 3 157 226 527 725 -10.974 -0.003 -9.628 -0.472 0.191 -2.315 0.953 + D 67 65 3 68 3 151 220 521 719 -10.269 -4.366 -0.073 + IL 68 68 3 68 3 156 226 528 726 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 16 ] 14 - G - - - + ML 69 68 3 71 3 156 225 526 724 -10.984 -0.003 -9.638 -5.681 -7.407 1.987 -6.434 + D 70 68 3 71 3 151 220 521 719 -10.225 -5.738 -0.029 + IL 71 71 3 71 3 156 225 527 725 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 17 ] 15 - G - - - + ML 72 71 3 74 3 155 224 525 723 -10.984 -0.003 -9.638 -3.778 -4.442 1.937 -4.298 + D 73 71 3 74 3 151 219 521 719 -10.225 -5.738 -0.029 + IL 74 74 3 74 3 155 224 526 724 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 18 ] 16 - a - - - + ML 75 74 3 77 3 154 223 524 722 -10.984 -0.003 -9.638 0.677 -0.761 -1.855 0.618 + D 76 74 3 77 3 151 219 521 719 -10.225 -5.738 -0.029 + IL 77 77 3 77 3 154 223 525 723 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 19 ] 17 - U - - - + ML 78 77 3 80 3 153 222 523 721 -10.984 -0.015 -6.670 -2.253 -3.016 -4.711 1.859 + D 79 77 3 80 3 151 219 521 719 -10.225 -2.367 -0.312 + IL 80 80 3 80 3 153 222 524 722 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 20 ] 18 - U - - - + ML 81 80 3 83 3 152 221 522 720 -5.130 -0.101 -4.688 -3.681 -3.088 -3.114 1.883 + D 82 80 3 83 3 150 219 520 718 -10.013 -3.909 -0.101 + IL 83 83 3 83 3 152 221 523 721 -1.877 -0.530 -4.835 0.000 0.000 0.000 0.000 + [ MATL 21 ] 21 - C - - - + ML 84 83 3 86 2 151 220 521 719 -11.610 -0.000 -5.607 1.901 -6.116 -2.120 + D 85 83 3 86 2 150 219 520 718 -9.401 -0.002 + IL 86 86 3 86 2 151 220 522 720 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 22 ] - - - - - - + B 87 86 3 145 88 150 219 520 718 + [ BEGR 287 ] - - - - - - + S 88 87 1 89 3 0 0 30 48 -6.750 -0.176 -3.241 + IL 89 89 2 89 3 1 1 32 50 -1.707 -0.706 -3.629 0.000 0.000 0.000 0.000 + [ MATL 288 ] 925 - C - - - + ML 90 89 2 92 5 1 1 30 48 -10.050 -0.082 -4.244 -10.078 -10.969 -3.219 1.930 -4.452 -4.748 + D 91 89 2 92 5 0 0 27 45 -7.643 -3.275 -6.905 -5.279 -0.222 + IL 92 92 3 92 5 1 1 30 48 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 289 ] 926 942 G C - - + MP 93 92 3 97 6 2 2 29 47 -11.109 -11.048 -0.037 -5.447 -10.104 -10.499 -5.278 -3.911 -5.099 1.198 -6.208 -4.381 0.353 -5.782 -5.522 3.435 -1.754 -1.552 -0.831 -4.948 -3.289 -4.064 + ML 94 92 3 97 6 1 1 26 45 -8.063 -8.409 -3.123 -0.222 -8.259 -5.788 -0.890 -2.230 1.548 -1.627 + MR 95 92 3 97 6 1 1 27 46 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 96 92 3 97 6 0 0 23 41 -12.073 -10.771 -6.568 -7.250 -7.268 -0.036 + IL 97 97 5 97 6 1 1 28 47 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 98 98 6 98 5 1 1 28 47 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 290 ] 927 941 c g - - + MP 99 98 6 103 6 2 2 27 45 -11.077 -11.016 -0.005 -9.793 -10.072 -10.467 -5.391 -4.972 -5.380 0.193 -4.426 -6.189 2.712 -5.029 -5.306 2.336 -5.797 -2.588 1.217 -3.852 -1.249 -4.031 + ML 100 98 6 103 6 1 1 25 43 -8.475 -8.821 -2.907 -0.388 -8.671 -3.393 -0.408 0.384 -0.117 0.027 + MR 101 98 6 103 6 1 1 25 44 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 102 98 6 103 6 0 0 21 40 -12.073 -10.771 -6.568 -7.250 -7.268 -0.036 + IL 103 103 5 103 6 1 1 26 45 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 104 104 6 104 5 1 1 26 45 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 291 ] 928 940 G C - - + MP 105 104 6 109 6 2 2 25 43 -11.083 -11.022 -0.005 -9.799 -10.078 -10.473 -8.593 -5.607 -9.716 -2.926 -9.899 -6.852 -0.195 -9.685 -6.966 3.879 -7.182 -2.481 -4.956 -7.232 -6.882 -8.601 + ML 106 104 6 109 6 1 1 23 42 -8.276 -8.622 -3.337 -1.535 -8.472 -0.869 -1.742 -2.986 1.758 -2.374 + MR 107 104 6 109 6 1 1 24 43 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 108 104 6 109 6 0 0 20 39 -12.157 -10.855 -6.652 -7.334 -7.351 -0.034 + IL 109 109 5 109 6 1 1 25 43 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 110 110 6 110 5 1 1 24 43 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 292 ] 929 939 G C - - + MP 111 110 6 115 6 2 2 23 41 -11.083 -11.022 -0.005 -9.799 -10.078 -10.473 -8.355 -5.602 -9.251 0.595 -10.085 -6.981 -4.728 -9.250 -6.937 3.834 -7.199 -3.415 -5.017 -7.320 -7.014 -8.007 + ML 112 110 6 115 6 1 1 23 42 -7.182 -7.528 -2.242 -1.598 -7.378 -1.184 -0.358 -1.334 1.152 -0.735 + MR 113 110 6 115 6 1 1 23 42 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 114 110 6 115 6 0 0 20 38 -12.557 -11.255 -7.052 -7.735 -7.752 -0.025 + IL 115 115 5 115 6 1 1 23 42 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 116 116 6 116 5 1 1 23 41 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 293 ] 930 938 G C - - + MP 117 116 6 121 4 2 2 21 39 -10.067 -10.274 -0.006 -8.688 -8.927 -5.652 -10.858 -3.089 -10.517 -6.842 -4.912 -10.456 -7.013 3.971 -7.216 -3.568 -5.277 -7.297 -7.330 -9.794 + ML 118 116 6 121 4 1 1 23 42 -3.893 -4.075 -0.453 -2.805 0.265 -0.616 0.300 -0.128 + MR 119 116 6 121 4 1 1 23 41 -4.809 -3.838 -1.706 -0.766 0.368 -0.385 -0.191 0.094 + D 120 116 6 121 4 0 0 19 38 -8.107 -7.789 -5.804 -0.038 + IL 121 121 5 121 4 1 1 25 43 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 122 122 6 122 3 1 1 24 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 294 ] 931 - U - - - + ML 123 122 6 125 3 1 1 18 36 -10.993 -0.003 -9.647 -6.543 -5.938 -7.446 1.988 + D 124 122 6 125 3 0 0 16 34 -10.183 -5.696 -0.029 + IL 125 125 3 125 3 1 1 23 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 295 ] 932 - U - - - + ML 126 125 3 128 3 1 1 17 35 -10.993 -0.003 -9.647 -6.543 -5.938 -7.446 1.988 + D 127 125 3 128 3 0 0 15 33 -10.183 -5.696 -0.029 + IL 128 128 3 128 3 1 1 22 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 296 ] 933 - C - - - + ML 129 128 3 131 3 1 1 15 34 -10.993 -0.007 -7.895 -6.367 1.984 -6.817 -5.462 + D 130 128 3 131 3 0 0 14 32 -10.183 -5.696 -0.029 + IL 131 131 3 131 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 297 ] 934 - G - - - + ML 132 131 3 134 3 1 1 14 32 -10.988 -0.003 -9.643 0.797 -5.389 1.144 -5.130 + D 133 131 3 134 3 0 0 13 31 -10.203 -5.716 -0.029 + IL 134 134 3 134 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 298 ] 935 - A - - - + ML 135 134 3 137 3 1 1 13 31 -10.988 -0.003 -9.643 1.989 -7.083 -6.414 -6.583 + D 136 134 3 137 3 0 0 12 30 -10.203 -5.716 -0.029 + IL 137 137 3 137 3 1 1 19 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 299 ] 936 - u - - - + ML 138 137 3 140 3 1 1 11 29 -10.988 -0.003 -9.643 -0.445 0.348 -1.806 0.771 + D 139 137 3 140 3 0 0 10 29 -10.203 -5.716 -0.029 + IL 140 140 3 140 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 300 ] 937 - U - - - + ML 141 140 3 143 2 1 1 1 1 * 0.000 -3.389 -2.689 -4.776 1.893 + D 142 140 3 143 2 0 0 0 0 * 0.000 + IL 143 143 3 143 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 301 ] - - - - - - + E 144 143 3 -1 0 0 0 0 0 + [ BEGL 23 ] - - - - - - + S 145 87 1 146 4 143 209 504 702 -0.270 -8.192 -3.350 -3.854 + [ MATP 24 ] 22 923 G A - - + MP 146 145 1 150 6 151 213 504 702 -11.068 -11.007 -0.010 -7.795 -10.063 -10.458 -7.145 -6.025 -7.108 -2.331 -6.873 -8.566 -2.550 -6.849 3.916 -2.644 -3.832 -3.374 -3.342 -8.106 -4.515 -5.800 + ML 147 145 1 150 6 142 207 502 700 -6.401 -6.747 -1.462 -0.867 -6.597 -4.127 0.289 -0.595 0.254 -0.115 + MR 148 145 1 150 6 143 208 502 700 -9.532 -8.261 -1.071 -5.353 -1.134 -4.661 1.730 -2.692 -1.606 -2.330 + D 149 145 1 150 6 136 199 497 695 -11.635 -10.334 -3.522 -3.839 -4.499 -0.326 + IL 150 150 5 150 6 144 210 503 701 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 151 151 6 151 5 145 210 503 701 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 25 ] 23 922 A G - - + MP 152 151 6 156 6 149 211 502 700 -11.149 -11.088 -0.007 -8.863 -10.144 -10.539 -7.326 -6.289 3.921 -2.592 -6.691 -8.412 -2.377 -6.884 -6.980 -2.891 -4.240 -3.665 -3.231 -8.140 -4.350 -5.936 + ML 153 151 6 156 6 142 206 500 698 -7.028 -7.374 -1.312 -0.890 -7.224 -4.753 1.189 -1.087 -0.831 -0.541 + MR 154 151 6 156 6 142 206 499 697 -8.684 -7.413 -2.787 -7.391 -0.286 -5.604 -1.465 -2.666 1.696 -2.052 + D 155 151 6 156 6 135 198 495 693 -11.436 -10.134 -5.931 -4.684 -6.631 -0.100 + IL 156 156 5 156 6 144 208 501 699 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 157 157 6 157 5 144 209 501 699 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 26 ] 24 921 C G - - + MP 158 157 6 162 6 147 209 500 698 -11.159 -11.098 -0.005 -9.875 -10.155 -10.550 -10.340 -10.574 -8.076 -7.051 -6.346 -7.716 3.991 -9.159 -9.980 -6.995 -7.749 -9.073 -4.981 -10.322 -5.959 -8.774 + ML 159 157 6 162 6 140 204 498 696 -6.931 -7.278 -1.151 -1.034 -7.127 -4.657 -0.242 0.718 -0.961 -0.006 + MR 160 157 6 162 6 142 205 498 696 -8.618 -7.347 -0.864 -7.325 -1.272 -5.538 -1.365 -2.550 1.669 -1.935 + D 161 157 6 162 6 135 198 495 693 -11.394 -10.092 -1.238 -6.571 -6.589 -0.852 + IL 162 162 5 162 6 142 206 499 697 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 163 163 6 163 5 143 207 499 697 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 27 ] 25 920 g c - - + MP 164 163 6 168 6 146 207 498 696 -11.249 -11.188 -0.014 -9.964 -7.099 -10.639 -5.410 -3.738 -5.234 2.438 -6.353 -5.844 -1.006 -5.909 -5.656 2.918 -5.911 -1.367 0.785 -5.100 -3.435 -3.584 + ML 165 163 6 168 6 139 202 495 693 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.879 -0.753 -0.485 -0.230 + MR 166 163 6 168 6 139 203 496 694 -7.769 -6.498 -1.568 -6.476 -0.744 -4.690 0.295 -0.548 -0.733 0.573 + D 167 163 6 168 6 133 196 491 689 -10.640 -9.338 -2.761 -5.817 -5.835 -0.295 + IL 168 168 5 168 6 141 205 497 695 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 169 169 6 169 5 142 205 497 695 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 28 ] 26 919 g u - - + MP 170 169 6 174 6 144 205 496 694 -11.253 -11.193 -0.009 -9.969 -7.994 -10.644 -2.586 -3.082 -2.767 0.511 -2.120 -3.934 0.824 -3.428 -2.870 1.400 -1.987 2.366 1.008 -3.224 0.209 -0.924 + ML 171 169 6 174 6 138 201 493 692 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 -0.017 -0.415 -0.619 0.687 + MR 172 169 6 174 6 138 201 494 692 -7.830 -6.559 -1.117 -6.537 -1.071 -4.751 -0.256 0.094 -0.966 0.663 + D 173 169 6 174 6 133 195 490 688 -10.457 -9.155 -3.243 -5.634 -5.652 -0.231 + IL 174 174 5 174 6 140 203 495 693 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 175 175 6 175 5 140 203 495 693 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 29 ] 27 918 g u - - + MP 176 175 6 180 6 142 203 494 692 -11.267 -11.206 -0.005 -9.983 -10.262 -10.657 -3.313 -1.194 -4.929 0.576 -4.663 -3.193 1.328 -2.517 -2.740 0.871 -2.790 2.870 -0.122 -3.281 -1.045 -2.623 + ML 177 175 6 180 6 137 199 492 690 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.140 -0.466 -0.075 0.293 + MR 178 175 6 180 6 136 199 491 689 -7.522 -6.251 -1.288 -6.230 -0.964 -4.443 0.406 -0.603 -0.089 0.107 + D 179 175 6 180 6 132 195 489 687 -10.347 -9.045 -0.914 -5.524 -5.542 -1.239 + IL 180 180 5 180 6 138 201 493 691 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 181 181 6 181 5 138 201 493 691 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 30 ] 28 917 a u - - + MP 182 181 6 186 6 140 202 492 690 -11.297 -11.237 -0.047 -5.060 -10.293 -10.688 -2.985 -3.368 -3.570 1.981 -3.657 -4.386 0.679 -3.955 -2.955 1.834 -2.557 1.869 0.432 -2.739 -0.859 -1.371 + ML 183 181 6 186 6 136 198 490 688 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.384 -0.466 -0.484 0.328 + MR 184 181 6 186 6 135 197 489 687 -7.226 -5.955 -1.864 -5.933 -0.667 -4.147 0.795 -0.684 -0.405 -0.173 + D 185 181 6 186 6 130 192 484 682 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 186 186 5 186 6 137 200 491 689 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 187 187 6 187 5 137 200 491 689 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 31 ] 29 916 g c - - + MP 188 187 6 192 6 138 200 490 688 -11.255 -11.194 -0.009 -9.971 -8.120 -10.645 -1.390 -3.000 -2.217 1.840 -2.982 -3.069 0.450 -2.112 -2.734 1.971 -3.629 -0.657 1.715 -2.594 -0.438 -0.180 + ML 189 187 6 192 6 136 197 489 687 -7.856 -8.202 -0.493 -1.959 -8.052 -5.582 -0.116 0.547 -0.761 0.038 + MR 190 187 6 192 6 134 195 487 685 -7.226 -5.955 -1.864 -5.933 -0.667 -4.147 0.062 -0.388 -0.533 0.586 + D 191 187 6 192 6 129 191 483 681 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 192 192 5 192 6 136 198 489 687 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 193 193 6 193 5 136 198 489 687 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 32 ] 30 915 u a - - + MP 194 193 6 198 6 136 198 488 686 -11.293 -11.233 -0.053 -6.875 -5.245 -10.684 -1.775 -3.020 -2.134 0.989 -1.924 -3.320 0.675 -2.658 -2.039 0.943 -2.812 -0.948 2.346 -2.096 1.376 -0.963 + ML 195 193 6 198 6 133 195 486 684 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.552 -0.532 -0.471 0.164 + MR 196 193 6 198 6 132 194 485 683 -7.390 -6.119 -1.504 -6.097 -0.831 -4.311 0.122 -0.089 -0.130 0.080 + D 197 193 6 198 6 129 190 482 680 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 198 198 5 198 6 135 196 487 685 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 199 199 6 199 5 135 196 487 685 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 33 ] 31 914 u g - - + MP 200 199 6 204 6 135 196 486 684 -11.249 -11.188 -0.102 -4.751 -6.462 -5.709 -1.501 -1.918 -1.600 1.360 -2.961 -1.361 1.394 -0.293 -1.826 0.986 -2.498 -0.130 0.479 -0.723 1.416 -0.988 + ML 201 199 6 204 6 132 193 484 682 -7.050 -7.397 -1.416 -1.153 -7.246 -2.686 0.686 -0.867 0.032 -0.286 + MR 202 199 6 204 6 130 192 483 681 -8.323 -7.052 -2.748 -7.030 -1.570 -1.011 -0.721 -0.647 -1.433 1.253 + D 203 199 6 204 6 129 190 481 679 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 204 204 5 204 6 133 195 486 684 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 205 205 6 205 5 133 195 486 684 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 34 ] 32 913 g g - - + MP 206 205 6 210 6 133 194 485 683 -11.160 -11.099 -0.175 -6.771 -3.408 -6.614 -0.450 -1.546 0.515 0.640 -1.601 -1.089 0.681 -1.391 0.489 0.323 1.313 -0.456 0.586 -1.851 0.145 -1.310 + ML 207 205 6 210 6 130 192 482 680 -8.017 -8.364 -3.078 -1.111 -8.213 -1.292 0.099 -1.004 0.581 -0.098 + MR 208 205 6 210 6 130 191 482 680 -7.854 -6.583 -2.492 -6.561 -1.424 -1.237 0.348 0.008 -0.497 0.019 + D 209 205 6 210 6 128 190 480 678 -11.257 -9.956 -5.753 -3.978 -6.452 -0.144 + IL 210 210 5 210 6 132 193 484 682 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 211 211 6 211 5 132 193 484 682 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 35 ] 33 912 c a - - + MP 212 211 6 216 4 131 192 483 681 -9.956 -10.163 -0.221 -2.832 -1.366 -1.536 -2.044 0.317 1.897 -2.543 0.452 -2.222 0.490 -0.009 -1.454 -0.724 1.530 -1.411 0.290 -1.155 + ML 213 211 6 216 4 130 191 482 680 -4.944 -5.127 -0.974 -1.218 0.324 -0.043 -0.876 0.302 + MR 214 211 6 216 4 129 191 481 679 -7.461 -6.490 -4.358 -0.098 0.426 0.058 -0.370 -0.249 + D 215 211 6 216 4 128 190 480 678 -7.443 -7.124 -5.140 -0.061 + IL 216 216 5 216 4 131 192 483 681 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 217 217 6 217 3 131 192 483 681 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 36 ] 34 - G - - - + ML 218 217 6 220 3 129 191 481 679 -10.691 -0.292 -2.453 0.077 -2.151 1.042 -0.596 + D 219 217 6 220 3 128 189 480 678 -11.096 -5.520 -0.032 + IL 220 220 3 220 3 130 191 482 680 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 37 ] 35 - A - - - + ML 221 220 3 223 3 128 190 480 678 -3.370 -1.551 -0.832 1.646 -2.305 -1.470 -1.707 + D 222 220 3 223 3 128 189 480 678 -1.751 -1.031 -2.228 + IL 223 223 3 223 3 130 191 481 679 -1.557 -0.616 -7.037 0.000 0.000 0.000 0.000 + [ MATL 38 ] 42 - a - - - + ML 224 223 3 226 3 128 190 480 678 -10.825 -0.361 -2.179 0.511 -0.557 -0.728 0.369 + D 225 223 3 226 3 127 188 478 676 -10.152 -1.029 -0.975 + IL 226 226 3 226 3 129 190 480 678 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 39 ] - 911 - g - - + MR 227 226 3 229 5 128 189 479 677 -1.842 -1.464 -2.376 -2.768 -5.711 -0.284 -0.028 0.230 0.036 + D 228 226 3 229 5 126 187 477 675 -9.307 -1.500 -6.933 -0.702 -5.514 + IR 229 229 3 229 5 130 190 480 678 -0.840 -1.409 -9.508 -4.034 -8.781 0.000 0.000 0.000 0.000 + [ MATP 40 ] 43 904 c g - - + MP 230 229 3 234 6 128 189 478 676 -10.501 -10.440 -0.030 -7.090 -6.528 -9.892 -0.373 -1.653 0.544 0.886 -1.988 -0.830 1.277 -1.226 0.346 0.759 -0.390 -0.393 0.834 -2.013 0.037 -1.348 + ML 231 229 3 234 6 127 187 477 675 -9.234 -9.580 -0.113 -3.989 -9.430 -6.959 -0.501 0.427 -0.155 0.071 + MR 232 229 3 234 6 127 187 477 675 -11.092 -9.821 -0.074 -9.799 -4.533 -8.013 -0.325 -1.335 0.371 0.596 + D 233 229 3 234 6 119 180 472 670 -10.111 -8.809 -1.871 -2.327 -5.306 -1.003 + IL 234 234 5 234 6 125 186 477 675 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 235 235 6 235 5 125 187 477 675 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 41 ] 44 903 a g - - + MP 236 235 6 240 6 127 187 476 674 -11.285 -11.224 -0.012 -10.000 -7.331 -10.675 -0.293 -0.669 1.785 0.689 -2.342 -3.003 0.518 -3.348 -1.661 0.473 -0.485 1.191 0.456 -1.719 -0.023 -1.818 + ML 237 235 6 240 6 123 183 474 672 -2.983 -7.164 -1.303 -1.284 -7.014 -4.543 0.610 -0.774 0.034 -0.208 + MR 238 235 6 240 6 123 183 473 671 -7.540 -6.269 -1.263 -6.247 -0.981 -4.461 0.591 -0.585 -0.607 0.227 + D 239 235 6 240 6 117 177 468 666 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 240 240 5 240 6 124 184 475 673 -2.754 -3.017 -0.935 -2.706 -5.448 -5.109 0.000 0.000 0.000 0.000 + IR 241 241 6 241 5 124 185 475 673 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 42 ] 46 902 c g - - + MP 242 241 6 246 6 125 185 474 672 -11.290 -11.229 -0.018 -7.154 -7.884 -10.680 -0.662 -1.668 0.784 1.476 -1.852 -0.724 1.585 -1.833 -1.906 0.199 -1.369 0.880 0.867 -3.141 -0.930 -1.834 + ML 243 241 6 246 6 121 181 471 669 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 -0.017 -0.415 -0.619 0.687 + MR 244 241 6 246 6 121 182 471 669 -7.536 -6.265 -1.671 -6.243 -0.716 -4.457 0.325 -0.297 -0.128 0.026 + D 245 241 6 246 6 116 177 467 665 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 246 246 5 246 6 123 183 473 671 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 247 247 6 247 5 123 183 473 671 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 43 ] 47 901 c g - - + MP 248 247 6 252 6 123 183 472 670 -11.280 -11.219 -0.032 -7.490 -6.046 -10.670 -1.847 -2.487 -2.737 0.869 0.589 -3.098 1.699 -2.204 -1.516 0.692 -0.967 1.213 0.977 -3.133 0.313 -1.458 + ML 249 247 6 252 6 120 180 470 668 -6.972 -7.318 -1.103 -1.075 -7.168 -4.698 -0.004 -0.035 -0.415 0.353 + MR 250 247 6 252 6 120 180 470 668 -7.580 -6.309 -2.217 -6.287 -0.494 -4.500 -0.257 -0.538 -0.884 0.951 + D 251 247 6 252 6 116 176 466 664 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 252 252 5 252 6 121 182 471 669 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 253 253 6 253 5 121 182 471 669 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 44 ] 48 900 c g - - + MP 254 253 6 258 6 121 181 470 668 -11.261 -11.200 -0.183 -4.017 -7.146 -4.341 -2.173 -1.837 -1.542 0.329 -1.585 -3.432 2.658 -2.124 -2.230 0.586 -1.392 -0.042 1.280 -3.120 -0.249 -1.059 + ML 255 253 6 258 6 118 178 467 665 -6.891 -7.237 -1.952 -0.994 -7.087 -2.205 -0.129 0.115 -0.826 0.524 + MR 256 253 6 258 6 119 179 468 666 -8.160 -6.889 -0.850 -6.867 -1.340 -5.080 0.445 -0.305 -0.418 0.112 + D 257 253 6 258 6 116 176 465 663 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 258 258 5 258 6 120 180 469 667 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 259 259 6 259 5 120 180 469 667 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 45 ] 49 899 c g - - + MP 260 259 6 264 6 119 179 468 666 -11.113 -11.052 -0.194 -6.552 -4.696 -3.730 -1.344 -2.284 -2.569 1.748 -1.373 -1.162 1.860 -2.246 -2.319 0.734 -2.841 -0.850 1.356 -1.132 -0.340 -0.265 + ML 261 259 6 264 6 117 177 466 664 -8.537 -8.883 -2.496 -2.859 -2.311 -1.063 0.177 -0.390 -1.002 0.685 + MR 262 259 6 264 6 117 177 466 664 -7.708 -6.437 -2.346 -6.416 -0.444 -4.629 0.204 -0.523 -0.727 0.630 + D 263 259 6 264 6 116 176 465 663 -11.444 -10.142 -2.106 -6.621 -1.877 -1.047 + IL 264 264 5 264 6 119 179 468 666 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 265 265 6 265 5 119 179 468 666 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 46 ] 50 898 u a - - + MP 266 265 6 270 6 118 178 467 665 -10.966 -10.905 -0.387 -6.429 -8.202 -2.190 0.997 -2.503 -2.754 1.232 -2.747 -2.216 0.820 -2.871 -1.013 0.990 -2.718 -0.952 1.744 -1.161 0.134 0.028 + ML 267 265 6 270 6 116 176 465 663 -7.002 -7.348 -1.260 -1.757 -7.198 -1.912 0.440 -0.521 -0.004 -0.075 + MR 268 265 6 270 6 116 176 465 663 -9.361 -8.090 -1.138 -8.068 -2.272 -1.601 0.566 -0.416 -0.502 0.090 + D 269 265 6 270 6 115 175 464 662 -12.470 -11.169 -1.212 -2.846 -7.665 -1.239 + IL 270 270 5 270 6 119 178 466 665 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 271 271 6 271 5 119 178 466 664 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 47 ] 51 897 g c - - + MP 272 271 6 276 6 119 178 465 663 -10.810 -10.749 -0.014 -9.526 -7.382 -10.201 -2.083 -2.691 -1.798 1.693 -2.689 -3.540 1.044 -2.743 -2.215 1.724 -0.140 0.841 1.111 -2.829 -0.364 -1.559 + ML 273 271 6 276 6 116 176 464 662 -7.645 -7.991 -0.371 -2.400 -7.841 -5.370 0.026 -0.652 -0.351 0.643 + MR 274 271 6 276 6 115 175 463 661 -7.674 -6.403 -0.950 -6.381 -1.515 -3.270 0.210 -0.201 -0.452 0.313 + D 275 271 6 276 6 113 173 461 659 -13.444 -12.142 -4.757 -4.069 -8.639 -0.151 + IL 276 276 5 276 6 117 176 465 663 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 277 277 6 277 5 117 176 464 662 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 48 ] 52 896 g c - - + MP 278 277 6 282 6 117 176 463 661 -10.893 -10.832 -0.013 -7.294 -9.888 -10.283 -2.085 -2.440 -1.259 1.780 -2.271 -2.903 0.799 -2.594 -1.850 1.809 -2.569 0.283 1.475 -1.995 -0.359 -0.985 + ML 279 277 6 282 6 113 173 462 660 -7.208 -7.554 -0.530 -1.963 -7.404 -4.933 -0.356 -0.371 -1.043 0.971 + MR 280 277 6 282 6 113 172 461 659 -3.604 -5.960 -1.868 -5.938 -0.849 -4.151 0.073 0.252 -0.614 0.142 + D 281 277 6 282 6 113 173 461 659 -13.319 -12.017 -0.132 -5.535 -6.405 -4.211 + IL 282 282 5 282 6 114 174 462 660 -2.685 -2.948 -0.691 -4.603 -5.379 -5.040 0.000 0.000 0.000 0.000 + IR 283 283 6 283 5 114 174 462 660 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 49 ] 54 895 a u - - + MP 284 283 6 288 6 115 174 461 659 -11.291 -11.230 -0.012 -10.007 -7.389 -10.681 -0.753 -2.381 0.981 1.557 -3.001 -3.859 0.529 -3.044 -2.754 1.431 0.525 0.159 0.628 -2.284 0.165 -1.889 + ML 285 283 6 288 6 110 170 458 656 -6.852 -7.198 -1.913 -0.955 -7.048 -2.355 0.235 -0.853 0.531 -0.278 + MR 286 283 6 288 6 112 171 459 657 -7.267 -5.996 -1.175 -5.974 -1.108 -4.187 0.189 -0.244 -0.032 0.053 + D 287 283 6 288 6 107 166 455 653 -9.359 -8.057 -3.854 -4.537 -4.554 -0.252 + IL 288 288 5 288 6 113 172 460 658 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 289 289 6 289 5 113 172 460 658 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 50 ] 55 894 g c - - + MP 290 289 6 294 6 113 172 459 657 -11.289 -11.228 -0.008 -8.276 -10.285 -10.680 0.798 -1.815 -1.379 0.785 -3.009 -3.331 0.962 -3.294 -2.801 2.001 -3.656 -0.171 0.970 -2.873 1.023 -1.503 + ML 291 289 6 294 6 110 169 457 655 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.580 -0.689 -0.019 -0.155 + MR 292 289 6 294 6 110 170 457 656 -7.334 -6.063 -1.095 -6.041 -1.175 -4.254 -0.019 0.403 -0.716 0.113 + D 293 289 6 294 6 106 166 454 652 -9.669 -8.367 -4.164 -4.846 -4.864 -0.199 + IL 294 294 5 294 6 111 171 459 657 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 295 295 6 295 5 111 170 458 656 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 51 ] 56 893 g c - - + MP 296 295 6 300 6 111 170 457 655 -11.293 -11.233 -0.075 -5.673 -5.084 -10.684 1.226 -2.895 -1.914 0.269 -2.693 -3.143 0.271 -3.356 -0.073 1.851 -1.543 -0.543 0.948 -0.134 0.204 -0.144 + ML 297 295 6 300 6 109 168 455 653 -6.757 -7.103 -1.817 -0.859 -3.269 -4.482 0.077 -0.562 0.157 0.205 + MR 298 295 6 300 6 109 168 456 654 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 299 295 6 300 6 106 165 453 651 -9.669 -8.367 -4.164 -2.389 -4.864 -0.484 + IL 300 300 5 300 6 110 169 457 655 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 301 301 6 301 5 110 169 457 655 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 52 ] 57 892 g a - - + MP 302 301 6 306 4 109 168 455 654 -1.723 -11.284 -1.062 -2.198 -1.979 -2.998 -0.961 -0.120 -2.501 -3.834 0.362 -3.329 2.420 0.025 0.201 -0.943 1.549 -2.453 0.083 -1.516 + ML 303 301 6 306 4 107 166 454 652 -2.471 -6.668 -3.428 -0.480 0.199 -0.537 0.127 0.098 + MR 304 301 6 306 4 108 167 454 652 -6.314 -14.741 -0.076 -4.697 0.775 -0.813 -0.921 0.253 + D 305 301 6 306 4 106 165 453 651 -13.995 -15.265 -3.293 -0.155 + IL 306 306 5 306 4 108 167 454 652 -6.242 -7.745 -0.073 -5.003 0.000 0.000 0.000 0.000 + IR 307 307 6 307 3 108 167 455 653 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 53 ] - 891 - G - - + MR 308 307 6 310 3 107 166 453 651 -1.365 -0.889 -3.798 -1.124 -2.289 1.194 0.069 + D 309 307 6 310 3 106 165 452 650 -1.002 -1.369 -3.139 + IR 310 310 3 310 3 108 166 453 651 -4.790 -0.071 -6.429 0.000 0.000 0.000 0.000 + [ MATR 54 ] - 887 - A - - + MR 311 310 3 313 3 107 165 452 650 -11.444 -0.002 -9.761 1.920 -5.017 -3.891 -3.095 + D 312 310 3 313 3 102 162 451 649 -9.179 -0.310 -2.383 + IR 313 313 3 313 3 105 164 452 650 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 55 ] - 886 - U - - + MR 314 313 3 316 5 106 164 451 649 -10.197 -0.004 -10.013 -10.225 -11.117 -3.169 -4.015 -0.978 1.731 + D 315 313 3 316 5 98 158 448 646 -5.815 -1.170 -1.959 -2.802 -2.866 + IR 316 316 3 316 5 102 162 451 649 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 56 ] 59 885 C G - - + MP 317 316 3 321 6 105 163 450 648 -11.302 -11.241 -0.005 -10.018 -10.298 -10.693 -8.152 -8.396 -7.468 -4.604 -3.357 -7.612 3.897 -1.758 -7.593 -4.558 -7.677 -2.019 -2.565 -8.004 -2.552 -6.392 + ML 318 316 3 321 6 99 158 447 645 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.005 0.366 -0.690 0.122 + MR 319 316 3 321 6 98 158 447 645 -7.206 -5.935 -1.844 -5.914 -0.679 -4.127 0.204 -0.671 0.409 -0.164 + D 320 316 3 321 6 94 152 442 640 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 321 321 5 321 6 101 160 449 647 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 322 322 6 322 5 101 161 449 647 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 57 ] 60 884 A U - - + MP 323 322 6 327 6 103 161 448 646 -11.302 -11.241 -0.005 -10.018 -10.298 -10.693 -2.437 -4.882 -6.169 3.252 -7.508 -7.149 -1.075 -6.647 -6.305 2.304 -6.712 -0.840 -2.852 -6.302 -4.617 -5.023 + ML 324 322 6 327 6 98 157 445 643 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.879 -0.753 -0.485 -0.230 + MR 325 322 6 327 6 97 156 445 643 -7.206 -5.935 -1.844 -5.914 -0.679 -4.127 0.096 0.212 -0.587 0.147 + D 326 322 6 327 6 93 152 441 639 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 327 327 5 327 6 100 159 447 645 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 328 328 6 328 5 100 159 447 645 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 58 ] 61 883 U A - - + MP 329 328 6 333 6 101 159 446 644 -11.302 -11.241 -0.005 -10.018 -10.298 -10.693 -5.645 -5.290 -5.646 1.431 -4.644 -6.475 0.659 -5.260 -5.546 1.144 -6.048 -2.007 3.111 -5.815 -1.405 -4.287 + ML 330 328 6 333 6 97 156 444 642 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 -0.017 -0.415 -0.619 0.687 + MR 331 328 6 333 6 96 155 443 641 -7.206 -5.935 -1.844 -5.914 -0.679 -4.127 0.204 -0.671 0.409 -0.164 + D 332 328 6 333 6 93 151 440 638 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 333 333 5 333 6 99 157 445 643 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 334 334 6 334 5 99 157 445 643 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 59 ] 62 882 G C - - + MP 335 334 6 339 6 99 157 444 642 -11.302 -11.241 -0.005 -10.018 -10.298 -10.693 -5.587 -3.515 -5.419 0.287 -6.535 -5.957 -0.018 -6.095 -5.794 3.590 -6.044 -1.402 0.015 -5.253 -3.613 -4.380 + ML 336 334 6 339 6 96 154 442 640 -6.612 -6.958 -1.672 -0.714 -6.808 -4.337 0.114 -0.763 0.563 -0.232 + MR 337 334 6 339 6 94 153 441 639 -7.206 -5.935 -1.844 -5.914 -0.679 -4.127 0.096 0.212 -0.587 0.147 + D 338 334 6 339 6 92 151 439 637 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 339 339 5 339 6 97 156 443 641 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 340 340 6 340 5 97 155 443 641 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 60 ] 63 881 C G - - + MP 341 340 6 345 4 97 155 442 640 -10.323 -10.530 -0.005 -8.944 -6.170 -5.933 -6.096 -1.805 -3.181 -6.816 3.102 -2.719 -5.993 -1.251 -3.469 -3.563 2.033 -6.321 1.039 -4.733 + ML 342 340 6 345 4 95 153 441 639 -4.036 -4.218 -0.404 -2.948 0.014 -0.059 -0.658 0.482 + MR 343 340 6 345 4 93 151 439 637 -5.059 -4.088 -1.955 -0.614 0.204 -0.671 0.409 -0.164 + D 344 340 6 345 4 92 150 438 636 -4.568 -4.250 -2.265 -0.520 + IL 345 345 5 345 4 96 154 442 640 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 346 346 6 346 3 96 154 441 640 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 61 ] 64 - C - - - + ML 347 346 6 349 3 95 153 440 638 -11.251 -0.002 -9.905 -2.121 1.779 -2.207 -3.034 + D 348 346 6 349 3 91 149 437 635 -6.573 -2.086 -0.407 + IL 349 349 3 349 3 95 153 440 639 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 62 ] 65 - G - - - + ML 350 349 3 352 3 94 152 439 637 -11.251 -0.002 -9.905 -2.060 -3.958 1.872 -4.852 + D 351 349 3 352 3 90 149 436 634 -6.573 -2.086 -0.407 + IL 352 352 3 352 3 94 152 440 638 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 63 ] 66 - A - - - + ML 353 352 3 355 3 93 151 438 636 -11.251 -0.002 -9.905 1.357 -2.326 -0.608 -0.779 + D 354 352 3 355 3 90 148 435 633 -6.573 -2.086 -0.407 + IL 355 355 3 355 3 93 151 439 637 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 64 ] 67 - G - - - + ML 356 355 3 358 3 92 150 437 635 -11.251 -0.064 -4.539 -1.473 -2.253 1.631 -1.585 + D 357 355 3 358 3 89 148 435 633 -6.573 -2.086 -0.407 + IL 358 358 3 358 3 92 150 438 636 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 65 ] 68 - G - - - + ML 359 358 3 361 3 91 149 436 634 -1.557 -0.609 -7.796 -0.829 -1.420 1.358 -0.999 + D 360 358 3 361 3 89 147 434 632 -7.427 -0.174 -3.210 + IL 361 361 3 361 3 91 149 436 634 -1.363 -0.727 -7.191 0.000 0.000 0.000 0.000 + [ MATR 66 ] - 880 - A - - + MR 362 361 3 364 3 90 148 435 633 -7.898 -0.008 -9.869 1.224 0.098 -3.938 -0.918 + D 363 361 3 364 3 86 144 432 630 -6.882 -2.059 -0.412 + IR 364 364 3 364 3 90 148 435 633 -1.446 -0.758 -4.593 0.000 0.000 0.000 0.000 + [ MATR 67 ] - 876 - A - - + MR 365 364 3 367 3 89 147 434 632 -11.552 -0.002 -9.869 1.792 -4.330 -1.155 -4.672 + D 366 364 3 367 3 86 144 431 629 -6.882 -2.059 -0.412 + IR 367 367 3 367 3 89 147 434 632 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 68 ] - 875 - U - - + MR 368 367 3 370 3 88 146 433 631 -3.652 -0.432 -2.480 -3.235 -3.820 -3.529 1.902 + D 369 367 3 370 3 85 143 430 628 -6.882 -2.059 -0.412 + IR 370 370 3 370 3 88 146 433 631 -1.654 -0.774 -3.355 0.000 0.000 0.000 0.000 + [ MATR 69 ] - 871 - C - - + MR 371 370 3 373 3 88 145 432 630 -11.246 -0.003 -9.563 -1.813 1.783 -3.876 -2.274 + D 372 370 3 373 3 85 143 430 628 -10.391 -0.633 -1.496 + IR 373 373 3 373 3 87 145 432 630 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 70 ] - 870 - A - - + MR 374 373 3 376 3 87 144 431 629 -11.462 -0.004 -8.617 1.175 -0.464 -0.723 -1.282 + D 375 373 3 376 3 83 141 427 625 -8.981 -4.158 -0.086 + IR 376 376 3 376 3 87 144 431 629 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 71 ] - 869 - G - - + MR 377 376 3 379 3 86 143 430 628 -11.460 -0.011 -7.115 0.373 -2.375 1.139 -1.687 + D 378 376 3 379 3 83 140 427 625 -9.005 -3.804 -0.110 + IR 379 379 3 379 3 86 143 430 628 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 72 ] - 868 - a - - + MR 380 379 3 382 3 85 142 429 627 -11.453 -0.818 -1.209 0.237 -0.331 0.105 -0.073 + D 381 379 3 382 3 83 140 427 625 -9.081 -3.063 -0.187 + IR 382 382 3 382 3 86 143 430 628 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 73 ] - 867 - u - - + MR 383 382 3 385 3 85 142 429 627 -10.654 -0.177 -3.119 -0.273 -0.012 -0.244 0.418 + D 384 382 3 385 3 83 140 427 625 -11.592 -1.206 -0.820 + IR 385 385 3 385 3 86 143 429 627 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 74 ] - 866 - a - - + MR 386 385 3 388 3 85 142 428 626 -10.996 -0.010 -7.299 0.651 -0.761 -0.068 -0.175 + D 387 385 3 388 3 82 139 426 624 -11.081 -0.341 -2.251 + IR 388 388 3 388 3 84 141 428 626 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 75 ] - 865 - c - - + MR 389 388 3 391 3 84 141 427 625 -11.462 -0.002 -9.779 0.355 0.477 -0.718 -0.472 + D 390 388 3 391 3 79 136 421 619 -8.981 -4.158 -0.086 + IR 391 391 3 391 3 83 141 427 625 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 76 ] - 864 - A - - + MR 392 391 3 394 3 83 140 426 624 -11.462 -0.008 -7.573 1.176 -0.615 -0.899 -0.859 + D 393 391 3 394 3 79 135 421 619 -8.981 -4.158 -0.086 + IR 394 394 3 394 3 83 140 426 624 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 77 ] - 863 - g - - + MR 395 394 3 397 3 82 139 425 623 -11.456 -0.149 -3.352 -0.270 -0.588 0.620 -0.045 + D 396 394 3 397 3 78 135 420 618 -9.050 -4.227 -0.082 + IR 397 397 3 397 3 82 139 425 623 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 78 ] - 862 - A - - + MR 398 397 3 400 3 81 138 424 622 -11.309 -0.248 -2.666 1.386 -1.253 -1.865 -0.530 + D 399 397 3 400 3 78 135 420 618 -10.117 -5.295 -0.039 + IR 400 400 3 400 3 82 139 425 623 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 79 ] - 861 - A - - + MR 401 400 3 403 3 81 138 424 622 -11.064 -0.215 -2.860 1.445 -2.502 -2.617 -0.094 + D 402 400 3 403 3 78 135 420 618 -10.934 -6.112 -0.022 + IR 403 403 3 403 3 82 139 424 622 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 80 ] - 860 - A - - + MR 404 403 3 406 3 81 137 423 621 -0.521 -1.763 -6.838 1.542 -1.622 -1.676 -1.151 + D 405 403 3 406 3 78 135 420 618 -11.332 -0.335 -2.275 + IR 406 406 3 406 3 80 137 422 620 -5.716 -0.043 -6.617 0.000 0.000 0.000 0.000 + [ MATR 81 ] - 858 - c - - + MR 407 406 3 409 3 79 136 421 619 -1.231 -1.972 -1.648 -0.303 0.391 -0.407 0.169 + D 408 406 3 409 3 77 133 412 610 -9.248 -4.426 -0.071 + IR 409 409 3 409 3 82 139 426 624 -0.189 -3.035 -10.836 0.000 0.000 0.000 0.000 + [ MATR 82 ] - 807 - a - - + MR 410 409 3 412 3 78 134 413 611 -10.885 -0.215 -2.860 0.748 -0.884 -1.535 0.520 + D 411 409 3 412 3 77 133 412 610 -11.282 -0.226 -2.788 + IR 412 412 3 412 3 78 135 413 611 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 83 ] - 806 - a - - + MR 413 412 3 415 3 77 134 412 610 -11.354 -0.002 -9.671 0.947 -0.916 -1.227 0.158 + D 414 412 3 415 3 74 130 409 607 -9.875 -1.648 -0.557 + IR 415 415 3 415 3 77 134 412 610 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 84 ] - 805 - A - - + MR 416 415 3 418 3 76 133 411 609 -11.422 -0.002 -9.740 1.402 -1.398 -0.553 -1.757 + D 417 415 3 418 3 74 130 408 606 -9.383 -3.419 -0.144 + IR 418 418 3 418 3 76 133 411 609 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 85 ] - 804 - A - - + MR 419 418 3 421 3 75 132 410 608 -11.431 -0.002 -9.748 1.727 -2.324 -1.606 -2.637 + D 420 418 3 421 3 73 130 408 606 -9.307 -3.908 -0.102 + IR 421 421 3 421 3 76 132 410 608 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 86 ] - 803 - g - - + MR 422 421 3 424 2 74 131 409 607 -11.759 -0.000 -0.420 -2.059 0.929 0.149 + D 423 421 3 424 2 73 130 408 606 -7.371 -0.009 + IR 424 424 3 424 2 75 131 409 607 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 87 ] - - - - - - + B 425 424 3 426 828 73 130 408 606 + [ BEGL 88 ] - - - - - - + S 426 425 1 427 1 13 53 307 505 0.000 + [ BIF 89 ] - - - - - - + B 427 426 1 566 428 13 53 307 505 + [ BEGR 165 ] - - - - - - + S 428 427 1 429 3 0 0 179 340 -11.256 -0.659 -1.448 + IL 429 429 2 429 3 1 2 183 344 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 166 ] 406 - g - - - + ML 430 429 2 432 3 1 2 182 343 -10.600 -0.226 -2.793 -0.306 -0.479 0.967 -0.947 + D 431 429 2 432 3 0 0 171 331 -11.265 -6.778 -0.014 + IL 432 432 3 432 3 1 2 183 344 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 167 ] 407 - c - - - + ML 433 432 3 435 5 1 3 182 343 -0.940 -1.100 -9.165 -6.700 -10.269 -0.185 0.576 -0.607 -0.039 + D 434 432 3 435 5 0 0 170 331 -2.639 -0.771 -8.820 -2.327 -4.271 + IL 435 435 3 435 5 1 3 186 347 -0.165 -3.632 -10.558 -5.338 -8.892 0.000 0.000 0.000 0.000 + [ MATP 168 ] 477 607 c g - - + MP 436 435 3 440 6 2 5 125 224 -11.014 -10.954 -0.006 -9.730 -10.010 -10.405 -2.921 -1.332 -3.110 0.656 -1.946 -3.408 2.821 -2.600 -2.833 1.198 -3.306 -0.963 1.214 -3.253 -1.093 -1.994 + ML 437 435 3 440 6 1 1 123 222 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 438 435 3 440 6 1 2 123 222 -10.263 -8.992 -0.510 -8.971 -1.804 -7.184 -0.453 0.359 -1.413 0.688 + D 439 435 3 440 6 0 0 115 214 -10.583 -9.282 -5.079 -5.761 -5.778 -0.102 + IL 440 440 5 440 6 1 1 124 223 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 441 441 6 441 5 1 1 124 223 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 169 ] 478 606 c g - - + MP 442 441 6 446 6 2 5 123 222 -11.215 -11.154 -0.005 -9.931 -10.211 -10.606 -2.785 -2.377 -2.605 1.263 -2.724 -2.042 2.416 -2.737 -3.049 1.682 -3.188 -0.654 1.033 -2.867 -0.592 -1.774 + ML 443 441 6 446 6 1 1 121 220 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 444 441 6 446 6 1 1 119 218 -8.670 -7.399 -3.308 -7.377 -0.211 -5.591 -0.601 1.153 -1.414 -0.432 + D 445 441 6 446 6 0 0 114 213 -10.583 -9.282 -5.079 -5.761 -5.778 -0.102 + IL 446 446 5 446 6 1 1 122 221 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 447 447 6 447 5 1 1 122 221 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 170 ] 479 605 u a - - + MP 448 447 6 452 6 2 5 121 220 -11.215 -11.154 -0.008 -9.931 -8.385 -10.606 -3.071 -2.897 -3.261 0.938 -3.180 -3.566 1.604 -2.115 -3.319 1.272 -3.889 -0.538 1.828 -3.088 1.631 -2.162 + ML 449 447 6 452 6 1 1 119 218 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 450 447 6 452 6 1 1 117 216 -8.670 -7.399 -3.308 -7.377 -0.211 -5.591 -0.676 1.155 -1.290 -0.438 + D 451 447 6 452 6 0 0 113 213 -10.583 -9.282 -5.079 -5.761 -5.778 -0.102 + IL 452 452 5 452 6 1 1 120 220 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 453 453 6 453 5 1 1 120 219 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 171 ] 480 604 c g - - + MP 454 453 6 458 6 2 4 119 218 -11.212 -11.151 -0.008 -8.356 -10.208 -10.603 -3.624 -3.758 -3.335 0.660 -1.732 -3.959 2.698 -3.984 -2.343 0.654 -4.390 -1.968 1.765 -3.432 0.632 -2.936 + ML 455 453 6 458 6 1 1 117 217 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 456 453 6 458 6 1 1 115 215 -8.718 -7.447 -3.355 -7.425 -0.204 -5.638 0.702 -0.216 -0.535 -0.283 + D 457 453 6 458 6 0 0 113 212 -10.583 -9.282 -5.079 -5.761 -5.778 -0.102 + IL 458 458 5 458 6 1 1 118 218 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 459 459 6 459 5 1 1 118 217 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 172 ] 481 603 c g - - + MP 460 459 6 464 6 2 2 117 216 -11.209 -11.148 -0.101 -4.716 -7.610 -5.394 -2.522 -2.525 -2.200 1.247 -1.794 -1.982 2.225 -3.300 -2.547 1.075 -3.590 -0.695 1.862 -2.538 -0.472 -2.089 + ML 461 459 6 464 6 1 1 116 215 -6.408 -6.754 -1.469 -0.862 -6.604 -4.134 0.283 -0.600 0.266 -0.118 + MR 462 459 6 464 6 1 1 114 213 -8.718 -7.447 -3.355 -4.716 -1.814 -0.806 1.129 -1.033 -0.529 -0.663 + D 463 459 6 464 6 0 0 112 212 -10.583 -9.282 -5.079 -5.761 -5.778 -0.102 + IL 464 464 5 464 6 1 1 116 216 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 465 465 6 465 5 1 1 116 216 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 173 ] 482 602 c g - - + MP 466 465 6 470 4 2 2 115 215 -10.102 -10.309 -0.780 -1.265 -1.749 -2.645 -1.933 1.166 -2.398 -1.569 2.036 -2.214 -2.004 1.676 -2.184 -0.983 1.385 -2.459 -0.131 -1.663 + ML 467 465 6 470 4 1 1 114 214 -5.218 -5.401 -0.749 -1.496 0.367 -0.765 -0.249 0.356 + MR 468 465 6 470 4 1 1 114 213 -5.560 -4.589 -2.456 -0.406 0.245 -0.097 -0.504 0.233 + D 469 465 6 470 4 0 0 112 212 -7.345 -7.026 -5.042 -0.065 + IL 470 470 5 470 4 1 1 116 215 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 471 471 6 471 3 1 1 115 215 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 174 ] 483 - u - - - + ML 472 471 6 474 3 1 1 114 213 -1.998 -0.565 -3.762 0.182 -0.555 -0.449 0.538 + D 473 471 6 474 3 0 0 112 211 -2.264 -1.451 -1.231 + IL 474 474 3 474 3 1 1 113 213 -1.599 -1.303 -1.918 0.000 0.000 0.000 0.000 + [ MATR 175 ] - 601 - a - - + MR 475 474 3 477 3 1 1 113 212 -10.961 -0.640 -1.483 0.770 -0.188 -0.892 -0.188 + D 476 474 3 477 3 0 0 110 209 -11.149 -1.606 -0.576 + IR 477 477 3 477 3 1 1 114 214 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 176 ] - 600 - a - - + MR 478 477 3 480 5 1 1 113 213 -0.653 -2.077 -3.753 -5.187 -5.288 0.680 -0.307 -1.298 0.242 + D 479 477 3 480 5 0 0 107 207 -1.997 -1.810 -4.488 -5.504 -1.330 + IR 480 480 3 480 5 1 1 115 214 -0.267 -2.664 -10.130 -7.625 -7.562 0.000 0.000 0.000 0.000 + [ MATP 177 ] 497 540 c g - - + MP 481 480 3 485 6 2 2 48 71 -10.849 -10.788 -0.031 -9.564 -6.213 -7.503 -1.828 -2.700 -2.684 0.744 -0.037 -2.765 2.281 -1.486 -2.667 0.168 -2.846 -0.778 1.806 -2.247 0.356 -1.309 + ML 482 480 3 485 6 1 1 47 69 -8.334 -8.680 -0.544 -1.781 -8.529 -6.059 -0.287 -0.538 -0.920 0.973 + MR 483 480 3 485 6 1 1 47 69 -8.420 -7.149 -0.801 -7.127 -1.380 -5.341 0.286 -0.845 0.244 0.056 + D 484 480 3 485 6 0 0 44 66 -13.040 -11.738 -3.677 -5.212 -5.432 -0.199 + IL 485 485 5 485 6 1 1 48 70 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 486 486 6 486 5 1 1 48 70 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 178 ] 498 539 c g - - + MP 487 486 6 491 6 2 2 46 69 -10.975 -10.914 -0.041 -9.690 -9.970 -5.339 -1.387 -2.166 -2.115 1.316 -0.526 -3.164 2.323 -1.617 -2.587 0.838 -3.084 -0.184 1.061 -2.225 -0.376 -0.954 + ML 488 486 6 491 6 1 1 45 67 -7.272 -7.618 -1.678 -0.646 -7.468 -4.997 0.111 -0.037 -0.812 0.460 + MR 489 486 6 491 6 1 1 45 67 -8.104 -6.833 -1.344 -6.811 -1.417 -2.251 0.117 -0.398 -0.298 0.426 + D 490 486 6 491 6 0 0 41 63 -12.889 -11.587 -5.077 -8.066 -8.084 -0.055 + IL 491 491 5 491 6 1 1 46 68 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 492 492 6 492 5 1 1 46 68 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 179 ] 499 538 c g - - + MP 493 492 6 497 6 2 3 44 67 -10.973 -10.912 -0.028 -8.206 -6.149 -10.364 -1.744 -2.354 -2.071 1.076 -1.988 -3.640 2.437 -2.299 -2.855 1.355 -2.860 -0.888 1.418 -2.930 -0.754 -1.191 + ML 494 492 6 497 6 1 1 43 66 -7.097 -7.443 -2.158 -0.705 -7.293 -2.806 -0.100 0.343 -0.647 0.214 + MR 495 492 6 497 6 1 1 43 65 -7.308 -6.037 -1.946 -6.015 -0.621 -4.229 0.555 -0.286 -0.517 0.017 + D 496 492 6 497 6 0 0 40 62 -13.052 -11.750 -5.366 -8.229 -8.246 -0.046 + IL 497 497 5 497 6 1 1 44 66 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 498 498 6 498 5 1 1 44 66 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 180 ] 500 537 u g - - + MP 499 498 6 503 4 2 2 42 65 -9.917 -10.124 -0.544 -1.679 -2.642 -2.264 -2.611 1.257 -2.543 -2.226 1.619 -3.176 -2.397 1.265 -3.475 -1.048 1.478 -2.979 1.651 -1.778 + ML 500 498 6 503 4 1 1 42 65 -4.371 -4.553 -0.311 -3.283 0.090 -0.500 -0.418 0.566 + MR 501 498 6 503 4 1 1 42 64 -5.752 -4.781 -2.648 -0.348 0.068 -0.360 -0.811 0.680 + D 502 498 6 503 4 0 0 40 62 -8.475 -8.156 -6.172 -0.029 + IL 503 503 5 503 4 1 1 44 66 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 504 504 6 504 3 1 1 43 66 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 181 ] 501 - a - - - + ML 505 504 6 507 3 1 1 41 63 -2.566 -0.374 -4.066 0.304 -0.062 -0.659 0.232 + D 506 504 6 507 3 0 0 39 62 -1.435 -2.359 -1.200 + IL 507 507 3 507 3 1 1 40 63 -2.960 -0.492 -2.639 0.000 0.000 0.000 0.000 + [ MATR 182 ] - 536 - c - - + MR 508 507 3 510 5 1 1 39 62 -1.919 -0.879 -4.220 -7.601 -2.911 -0.429 0.421 0.051 -0.180 + D 509 507 3 510 5 0 0 35 55 -9.086 -0.560 -2.322 -8.143 -3.102 + IR 510 510 3 510 5 1 1 40 62 -1.188 -1.003 -5.232 -7.354 -5.090 0.000 0.000 0.000 0.000 + [ MATP 183 ] 504 531 c g - - + MP 511 510 3 515 6 2 2 35 54 -10.960 -10.899 -0.011 -7.692 -9.956 -10.351 -2.380 -2.043 -2.751 1.270 -1.592 -3.295 1.568 -2.482 0.826 1.493 -2.437 0.490 0.791 -1.538 -0.444 -1.175 + ML 512 510 3 515 6 1 1 34 52 -9.003 -9.349 -0.589 -1.640 -9.199 -6.729 -0.241 -0.073 0.028 0.242 + MR 513 510 3 515 6 1 1 33 52 -7.170 -5.899 -1.306 -5.877 -1.011 -4.091 0.121 -0.374 -0.468 0.504 + D 514 510 3 515 6 0 0 31 50 -12.434 -11.133 -3.071 -4.916 -5.145 -0.288 + IL 515 515 5 515 6 1 1 35 54 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 516 516 6 516 5 1 1 34 53 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 184 ] 505 530 c g - - + MP 517 516 6 521 6 2 2 33 52 -11.102 -11.041 -0.064 -5.271 -5.996 -10.493 -1.889 -2.097 -1.910 1.141 -2.616 -2.993 2.410 -3.015 -2.050 1.365 -3.502 0.048 0.788 -3.002 0.160 -1.366 + ML 518 516 6 521 6 1 1 31 50 -7.867 -8.213 -2.412 -0.430 -8.063 -4.093 -0.057 0.322 -0.697 0.229 + MR 519 516 6 521 6 1 1 31 50 -7.209 -5.938 -1.846 -5.916 -0.678 -4.129 0.202 -0.673 0.412 -0.166 + D 520 516 6 521 6 0 0 27 47 -12.179 -10.878 -6.675 -7.357 -4.656 -0.084 + IL 521 521 5 521 6 1 1 33 52 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 522 522 6 522 5 1 1 32 51 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 185 ] 506 529 a u - - + MP 523 522 6 527 6 2 2 31 50 -11.049 -10.988 -0.018 -7.356 -7.713 -10.440 -2.366 -2.460 -1.758 1.706 -2.337 -1.894 1.448 -3.169 -2.614 1.519 -2.403 -0.131 1.515 -2.667 0.253 -1.242 + ML 524 522 6 527 6 1 1 30 49 -8.283 -8.629 -1.032 -1.143 -8.479 -4.335 -0.013 -0.062 -0.964 0.622 + MR 525 522 6 527 6 1 1 30 49 -8.020 -6.749 -1.567 -6.728 -0.720 -4.941 0.805 -1.007 0.014 -0.424 + D 526 522 6 527 6 0 0 26 46 -12.155 -10.853 -6.650 -7.333 -7.350 -0.034 + IL 527 527 5 527 6 1 1 31 50 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 528 528 6 528 5 1 1 30 49 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 186 ] 507 528 u g - - + MP 529 528 6 533 4 2 2 29 48 -10.078 -10.285 -0.053 -4.873 -2.652 -2.606 -2.379 0.769 -2.843 -2.554 1.230 -2.729 -0.942 1.344 -2.547 -0.680 1.651 -2.287 1.698 -0.917 + ML 530 528 6 533 4 1 1 29 48 -4.894 -5.076 -0.209 -3.806 -0.136 -0.039 -0.195 0.313 + MR 531 528 6 533 4 1 1 28 48 -5.794 -4.822 -2.690 -0.337 -0.153 -0.560 -0.425 0.747 + D 532 528 6 533 4 0 0 26 46 -7.618 -7.299 -5.315 -0.054 + IL 533 533 5 533 4 1 1 31 51 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 534 534 6 534 3 1 1 30 49 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 187 ] 508 - u - - - + ML 535 534 6 537 3 1 1 27 46 -11.006 -0.419 -1.990 -0.630 0.348 -0.390 0.398 + D 536 534 6 537 3 0 0 24 43 -10.118 -5.631 -0.031 + IL 537 537 3 537 3 1 1 29 49 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 188 ] 509 - c - - - + ML 538 537 3 540 3 1 1 26 45 -1.234 -0.890 -4.828 -0.626 0.435 -0.375 0.297 + D 539 537 3 540 3 0 0 24 43 -2.771 -0.410 -3.308 + IL 540 540 3 540 3 1 1 26 45 -1.412 -0.690 -7.819 0.000 0.000 0.000 0.000 + [ MATL 189 ] 515 - G - - - + ML 541 540 3 543 3 1 1 21 38 -11.179 -0.002 -9.833 -1.144 -0.869 1.230 -0.613 + D 542 540 3 543 3 0 0 20 38 -8.690 -1.172 -0.853 + IL 543 543 3 543 3 1 1 25 43 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 190 ] 516 - C - - - + ML 544 543 3 546 3 1 1 20 37 -11.216 -0.005 -8.257 -1.976 1.279 -1.804 0.046 + D 545 543 3 546 3 0 0 19 37 -7.978 -2.314 -0.331 + IL 546 546 3 546 3 1 1 24 42 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 191 ] 517 - c - - - + ML 547 546 3 549 3 1 1 19 36 -11.219 -0.012 -6.994 -1.431 0.924 -2.166 0.594 + D 548 546 3 549 3 0 0 18 36 -7.894 -3.407 -0.150 + IL 549 549 3 549 3 1 1 23 41 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 192 ] 518 - c - - - + ML 550 549 3 552 3 1 1 18 35 -11.209 -0.289 -2.464 -1.192 0.911 -0.956 0.222 + D 551 549 3 552 3 0 0 17 35 -8.135 -2.652 -0.256 + IL 552 552 3 552 3 1 1 22 40 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 193 ] 519 - a - - - + ML 553 552 3 555 3 1 1 17 33 -10.929 -0.003 -9.583 0.385 -1.000 0.162 0.105 + D 554 552 3 555 3 0 0 16 33 -10.450 -0.270 -2.557 + IL 555 555 3 555 3 1 1 21 39 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 194 ] 520 - u - - - + ML 556 555 3 558 3 1 1 16 32 -11.214 -0.546 -1.669 -0.805 -0.173 -0.361 0.817 + D 557 555 3 558 3 0 0 15 33 -8.029 -2.877 -0.218 + IL 558 558 3 558 3 1 1 20 38 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 195 ] 521 - u - - - + ML 559 558 3 561 3 1 1 15 30 -1.340 -1.796 -1.657 -0.326 -1.054 0.145 0.691 + D 560 558 3 561 3 0 0 13 28 -2.362 -2.705 -0.617 + IL 561 561 3 561 3 1 1 15 30 -1.769 -0.511 -7.668 0.000 0.000 0.000 0.000 + [ MATL 196 ] 527 - g - - - + ML 562 561 3 564 2 1 1 1 1 * 0.000 -0.295 0.075 0.525 -0.530 + D 563 561 3 564 2 0 0 0 0 * 0.000 + IL 564 564 3 564 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 197 ] - - - - - - + E 565 564 3 -1 0 0 0 0 0 + [ BEGL 90 ] - - - - - - + S 566 427 1 567 1 0 27 252 449 0.000 + [ BIF 91 ] - - - - - - + B 567 566 1 568 648 0 27 252 449 + [ BEGL 92 ] - - - - - - + S 568 567 1 569 4 0 0 56 91 -0.160 -6.593 -3.744 -5.637 + [ MATP 93 ] 74 112 g c - - + MP 569 568 1 573 6 2 2 56 91 -11.170 -11.109 -0.005 -9.886 -10.166 -10.561 0.604 -1.909 -2.078 0.193 -0.823 -1.330 0.737 -3.260 0.962 1.720 -2.777 -0.677 1.471 -1.874 -0.612 -1.374 + ML 570 568 1 573 6 1 1 55 89 -6.848 -7.194 -0.723 -1.603 -7.044 -4.573 0.077 -0.359 0.088 0.141 + MR 571 568 1 573 6 1 1 55 89 -9.205 -7.934 -0.400 -7.913 -2.200 -6.126 0.945 -0.626 -0.949 -0.138 + D 572 568 1 573 6 0 0 52 87 -10.299 -8.997 -2.492 -1.660 -2.591 -1.569 + IL 573 573 5 573 6 1 1 56 90 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 574 574 6 574 5 1 1 55 90 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 94 ] 75 111 g c - - + MP 575 574 6 579 6 2 2 54 89 -11.282 -11.221 -0.005 -9.997 -10.277 -10.672 -0.486 -3.014 -2.526 0.282 -1.303 -3.633 1.439 -3.054 -1.700 2.273 -3.639 -0.028 1.422 -2.213 -0.046 -1.370 + ML 576 574 6 579 6 1 1 53 87 -6.882 -7.228 -0.985 -1.214 -7.077 -4.607 1.091 -0.964 -0.711 -0.421 + MR 577 574 6 579 6 1 1 52 87 -7.738 -6.467 -1.321 -6.446 -0.909 -4.659 0.151 -0.156 -0.365 0.282 + D 578 574 6 579 6 0 0 49 83 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 579 579 5 579 6 1 1 54 88 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 580 580 6 580 5 1 1 53 88 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 95 ] 76 110 c g - - + MP 581 580 6 585 6 2 2 52 87 -11.300 -11.240 -0.025 -10.016 -7.797 -6.481 -2.819 -2.805 -1.537 0.964 -1.659 -3.469 2.423 -3.368 -1.063 1.375 -2.138 -1.210 1.080 -3.158 0.148 -1.032 + ML 582 580 6 585 6 1 1 51 85 -6.476 -6.822 -1.030 -1.231 -6.672 -4.202 0.104 -0.377 -0.487 0.528 + MR 583 580 6 585 6 1 1 50 84 -7.403 -6.131 -2.040 -6.110 -0.573 -4.323 -0.077 0.493 -0.780 0.088 + D 584 580 6 585 6 0 0 47 81 -9.049 -7.747 -3.544 -4.226 -4.244 -0.319 + IL 585 585 5 585 6 1 1 52 86 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 586 586 6 586 5 1 1 51 86 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 96 ] 77 109 g c - - + MP 587 586 6 591 6 2 2 50 85 -11.284 -11.223 -0.076 -9.999 -5.091 -5.653 -2.154 -2.687 -3.043 1.875 -2.254 -3.195 1.380 -2.866 -2.533 2.381 -3.286 -0.862 0.678 -2.279 -0.495 -2.165 + ML 588 586 6 591 6 1 1 48 83 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 589 586 6 591 6 1 1 48 82 -7.600 -6.329 -1.557 -6.307 -0.770 -4.521 0.299 -0.224 -0.392 0.204 + D 590 586 6 591 6 0 0 44 78 -9.913 -8.611 -4.408 -5.090 -5.108 -0.167 + IL 591 591 5 591 6 1 1 50 84 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 592 592 6 592 5 1 1 49 84 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 97 ] 78 108 g c - - + MP 593 592 6 597 6 2 2 48 83 -11.219 -11.158 -0.087 -5.516 -5.074 -7.364 -2.321 -2.770 -3.062 0.879 -1.201 -2.110 1.836 -3.100 -2.623 2.496 -3.326 0.096 0.505 -3.198 -0.786 -1.943 + ML 594 592 6 597 6 1 1 46 81 -6.250 -6.596 -1.310 -1.005 -6.446 -3.975 0.368 -0.385 -0.191 0.094 + MR 595 592 6 597 6 1 1 45 79 -8.485 -7.214 -3.123 -7.192 -0.243 -5.406 0.528 -0.224 -0.617 0.069 + D 596 592 6 597 6 0 0 42 76 -10.769 -9.467 -5.264 -5.946 -5.964 -0.090 + IL 597 597 5 597 6 1 1 48 82 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 598 598 6 598 5 1 1 47 82 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 98 ] 79 107 u a - - + MP 599 598 6 603 6 2 2 46 81 -11.137 -11.076 -0.152 -5.064 -4.149 -6.258 -1.689 -2.424 -1.677 1.103 -1.426 -3.319 1.355 -3.234 -0.849 0.987 -2.709 -0.273 1.815 -2.489 1.289 -2.023 + ML 600 598 6 603 6 1 1 44 78 -7.385 -7.731 -2.446 -2.140 -7.581 -0.802 1.397 -1.421 -1.145 -0.887 + MR 601 598 6 603 6 1 1 43 77 -9.080 -7.809 -3.717 -7.787 -1.158 -1.104 1.168 -0.403 -1.335 -0.735 + D 602 598 6 603 6 0 0 41 75 -10.933 -9.631 -5.428 -6.111 -6.128 -0.080 + IL 603 603 5 603 6 1 1 46 80 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 604 604 6 604 5 1 1 46 80 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 99 ] 80 106 u a - - + MP 605 604 6 609 4 2 2 44 79 -0.489 -10.163 -2.421 -3.324 0.189 -1.267 -2.171 0.702 -0.260 -3.624 1.043 -2.811 -0.370 1.295 -1.548 -1.267 2.038 -1.339 -0.659 -1.494 + ML 606 604 6 609 4 1 1 43 77 -1.532 -5.055 -0.859 -3.784 0.371 -0.536 -0.186 0.186 + MR 607 604 6 609 4 1 1 41 76 -7.286 -6.315 -1.735 -0.555 0.723 -0.019 -1.226 -0.097 + D 608 604 6 609 4 0 0 40 74 -7.633 -7.314 -3.457 -0.156 + IL 609 609 5 609 4 1 1 43 77 -1.344 -7.820 -1.059 -3.041 0.000 0.000 0.000 0.000 + IR 610 610 6 610 3 1 1 43 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 100 ] 87 - g - - - + ML 611 610 6 613 3 1 1 41 75 -10.623 -0.003 -9.277 -0.105 -0.359 0.811 -0.899 + D 612 610 6 613 3 0 0 40 74 -11.226 -0.300 -2.417 + IL 613 613 3 613 3 1 1 42 76 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 101 ] 88 - C - - - + ML 614 613 3 616 3 1 1 40 74 -11.165 -0.002 -9.819 -0.922 1.188 -1.419 -0.288 + D 615 613 3 616 3 0 0 39 73 -8.883 -0.382 -2.119 + IL 616 616 3 616 3 1 1 41 75 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 102 ] 89 - C - - - + ML 617 616 3 619 3 1 1 39 73 -11.243 -0.002 -9.897 -1.501 1.537 -2.082 -0.977 + D 618 616 3 619 3 0 0 37 72 -7.046 -1.156 -0.880 + IL 619 619 3 619 3 1 1 40 74 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 103 ] 90 - U - - - + ML 620 619 3 622 3 1 1 38 72 -11.251 -0.002 -9.905 -0.851 -0.963 -2.195 1.441 + D 621 619 3 622 3 0 0 36 71 -6.573 -1.067 -0.965 + IL 622 622 3 622 3 1 1 39 73 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 104 ] 91 - C - - - + ML 623 622 3 625 3 1 1 37 71 -11.256 -0.002 -9.910 -3.972 1.834 -4.301 -1.644 + D 624 622 3 625 3 0 0 35 69 -6.174 -1.687 -0.566 + IL 625 625 3 625 3 1 1 38 72 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 105 ] 92 - G - - - + ML 626 625 3 628 3 1 1 36 70 -11.256 -0.012 -6.942 -2.927 -2.370 1.748 -1.661 + D 627 625 3 628 3 0 0 34 68 -6.174 -1.687 -0.566 + IL 628 628 3 628 3 1 1 37 71 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 106 ] 93 - U - - - + ML 629 628 3 631 3 1 1 35 69 -11.246 -0.008 -7.687 -1.873 -2.415 -3.859 1.795 + D 630 628 3 631 3 0 0 32 66 -6.890 -2.403 -0.317 + IL 631 631 3 631 3 1 1 36 70 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 107 ] 94 - A - - - + ML 632 631 3 634 3 1 1 34 68 -11.240 -0.005 -8.352 1.208 -1.918 -2.184 0.269 + D 633 631 3 634 3 0 0 31 65 -7.163 -2.676 -0.258 + IL 634 634 3 634 3 1 1 35 69 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 108 ] 95 - A - - - + ML 635 634 3 637 3 1 1 33 67 -11.237 -0.097 -3.948 1.909 -3.399 -4.150 -3.403 + D 636 634 3 637 3 0 0 29 64 -7.288 -2.801 -0.234 + IL 637 637 3 637 3 1 1 34 68 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 109 ] 96 - A - - - + ML 638 637 3 640 3 1 1 32 67 -11.142 -0.478 -1.827 1.730 -3.229 -2.111 -1.533 + D 639 637 3 640 3 0 0 27 61 -9.149 -4.662 -0.061 + IL 640 640 3 640 3 1 1 33 68 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 110 ] 97 - u - - - + ML 641 640 3 643 3 1 1 32 66 -0.605 -1.767 -4.362 0.295 0.100 -2.547 0.613 + D 642 640 3 643 3 0 0 24 59 -5.371 -0.729 -1.425 + IL 643 643 3 643 3 1 1 31 66 -0.771 -1.699 -3.238 0.000 0.000 0.000 0.000 + [ MATL 111 ] 105 - A - - - + ML 644 643 3 646 2 1 1 1 1 * 0.000 1.246 -0.463 -1.119 -1.178 + D 645 643 3 646 2 0 0 0 0 * 0.000 + IL 646 646 3 646 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 112 ] - - - - - - + E 647 646 3 -1 0 0 0 0 0 + [ BEGR 113 ] - - - - - - + S 648 567 1 649 3 0 5 225 423 -1.122 -1.687 -2.120 + IL 649 649 2 649 3 1 9 227 424 -0.994 -1.013 -8.617 0.000 0.000 0.000 0.000 + [ MATL 114 ] 118 - A - - - + ML 650 649 2 652 3 1 7 224 422 -10.881 -0.003 -9.535 1.058 -0.673 -1.858 0.021 + D 651 649 2 652 3 0 1 223 421 -10.616 -0.757 -1.294 + IL 652 652 3 652 3 1 6 225 423 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 115 ] 119 - A - - - + ML 653 652 3 655 3 1 6 223 421 -11.119 -0.008 -7.535 1.516 -1.434 -2.491 -0.756 + D 654 652 3 655 3 0 0 222 420 -9.373 -0.338 -2.270 + IL 655 655 3 655 3 1 3 224 422 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 116 ] 120 - A - - - + ML 656 655 3 658 3 1 6 222 420 -11.231 -0.002 -9.885 1.369 -0.667 -1.543 -1.169 + D 657 655 3 658 3 0 0 220 418 -7.541 -1.965 -0.437 + IL 658 658 3 658 3 1 2 223 421 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 117 ] 121 - A - - - + ML 659 658 3 661 3 1 5 221 419 -11.236 -0.002 -9.890 1.065 -0.417 -1.998 -0.139 + D 660 658 3 661 3 0 0 220 417 -7.331 -0.896 -1.131 + IL 661 661 3 661 3 1 1 222 420 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 118 ] 122 - A - - - + ML 662 661 3 664 3 1 4 220 418 -11.251 -0.005 -8.263 1.072 -1.685 -1.639 0.340 + D 663 661 3 664 3 0 0 218 416 -6.599 -1.040 -0.990 + IL 664 664 3 664 3 1 1 221 419 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 119 ] 123 - A - - - + ML 665 664 3 667 3 1 4 219 417 -11.253 -0.002 -9.907 1.622 -2.826 -1.751 -1.049 + D 666 664 3 667 3 0 0 217 415 -6.437 -1.234 -0.828 + IL 667 667 3 667 3 1 1 220 418 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 120 ] 124 - U - - - + ML 668 667 3 670 3 1 4 218 416 -11.256 -0.002 -9.910 -2.884 -1.900 -4.514 1.829 + D 669 667 3 670 3 0 0 216 413 -6.174 -1.687 -0.566 + IL 670 670 3 670 3 1 1 219 417 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 121 ] 125 - A - - - + ML 671 670 3 673 3 1 3 217 415 -11.256 -0.002 -9.910 1.969 -6.656 -3.967 -6.339 + D 672 670 3 673 3 0 0 215 412 -6.174 -1.687 -0.566 + IL 673 673 3 673 3 1 1 218 416 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 122 ] 126 - A - - - + ML 674 673 3 676 3 1 3 216 414 -11.256 -0.002 -9.910 1.360 -2.944 0.297 -3.735 + D 675 673 3 676 3 0 0 214 411 -6.174 -1.687 -0.566 + IL 676 676 3 676 3 1 1 217 415 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 123 ] 127 - u - - - + ML 677 676 3 679 3 1 2 215 413 -11.256 -0.002 -9.910 -0.206 0.286 -1.021 0.507 + D 678 676 3 679 3 0 0 213 410 -6.174 -1.687 -0.566 + IL 679 679 3 679 3 1 1 216 414 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 124 ] 128 - U - - - + ML 680 679 3 682 3 1 2 214 412 -11.256 -0.002 -9.910 -2.927 0.372 -4.034 1.330 + D 681 679 3 682 3 0 0 212 409 -6.174 -1.687 -0.566 + IL 682 682 3 682 3 1 1 215 413 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 125 ] 129 - G - - - + ML 683 682 3 685 3 1 2 213 411 -11.256 -0.002 -9.910 -4.458 -7.451 1.975 -5.859 + D 684 682 3 685 3 0 0 211 408 -6.174 -1.687 -0.566 + IL 685 685 3 685 3 1 1 214 412 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 126 ] 130 - C - - - + ML 686 685 3 688 3 1 1 212 410 -11.256 -0.002 -9.910 -3.372 1.766 -1.371 -3.108 + D 687 685 3 688 3 0 0 209 407 -6.174 -1.687 -0.566 + IL 688 688 3 688 3 1 1 213 411 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 127 ] 131 - a - - - + ML 689 688 3 691 3 1 1 211 409 -11.256 -0.002 -9.910 0.862 0.588 -2.153 -1.139 + D 690 688 3 691 3 0 0 208 406 -6.174 -1.687 -0.566 + IL 691 691 3 691 3 1 1 212 410 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 128 ] 132 - A - - - + ML 692 691 3 694 3 1 1 210 408 -11.256 -0.002 -9.910 1.658 -3.583 -0.457 -4.960 + D 693 691 3 694 3 0 0 207 405 -6.174 -1.687 -0.566 + IL 694 694 3 694 3 1 1 211 409 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 129 ] 133 - A - - - + ML 695 694 3 697 3 1 1 209 407 -11.256 -0.012 -6.942 1.943 -3.162 -5.641 -5.439 + D 696 694 3 697 3 0 0 205 403 -6.174 -1.687 -0.566 + IL 697 697 3 697 3 1 1 210 407 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 130 ] 134 - C - - - + ML 698 697 3 700 3 1 1 208 406 -11.246 -0.002 -9.900 0.032 1.037 -2.463 -0.425 + D 699 697 3 700 3 0 0 203 401 -6.890 -2.403 -0.317 + IL 700 700 3 700 3 1 1 209 406 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 131 ] 135 - g - - - + ML 701 700 3 703 3 1 1 207 405 -11.246 -0.002 -9.900 0.483 -1.434 0.815 -1.079 + D 702 700 3 703 3 0 0 202 400 -6.890 -2.403 -0.317 + IL 703 703 3 703 3 1 1 208 405 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 132 ] 136 - A - - - + ML 704 703 3 706 3 1 1 206 404 -11.246 -0.002 -9.900 1.697 -0.755 -3.671 -3.538 + D 705 703 3 706 3 0 0 201 398 -6.890 -2.403 -0.317 + IL 706 706 3 706 3 1 1 207 404 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 133 ] 137 - c - - - + ML 707 706 3 709 3 1 1 205 403 -11.246 -0.005 -8.303 -0.360 0.957 -2.124 0.071 + D 708 706 3 709 3 0 0 199 397 -6.890 -2.403 -0.317 + IL 709 709 3 709 3 1 1 206 403 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 134 ] 138 - a - - - + ML 710 709 3 712 3 1 1 205 402 -11.243 -0.010 -7.331 0.795 -1.826 0.755 -1.760 + D 711 709 3 712 3 0 0 197 395 -7.048 -2.561 -0.281 + IL 712 712 3 712 3 1 1 205 402 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 135 ] 139 - A - - - + ML 713 712 3 715 3 1 1 204 401 -11.235 -0.024 -5.977 1.543 -0.894 -2.587 -1.393 + D 714 712 3 715 3 0 0 195 392 -7.373 -2.886 -0.220 + IL 715 715 3 715 3 1 1 204 401 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 136 ] 140 - a - - - + ML 716 715 3 718 3 1 1 203 400 -11.214 -0.067 -4.475 0.493 -0.072 -1.110 0.237 + D 717 715 3 718 3 0 0 192 390 -8.030 -3.543 -0.135 + IL 718 718 3 718 3 1 1 203 401 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 137 ] 141 - a - - - + ML 719 718 3 721 3 1 1 202 400 -11.149 -0.011 -7.093 0.995 -0.147 -0.869 -0.847 + D 720 718 3 721 3 0 0 191 389 -9.077 -4.590 -0.064 + IL 721 721 3 721 3 1 1 202 400 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 138 ] 142 - A - - - + ML 722 721 3 724 3 1 1 201 399 -11.140 -0.041 -5.190 1.323 -0.639 -1.338 -1.117 + D 723 721 3 724 3 0 0 190 388 -9.175 -4.688 -0.060 + IL 724 724 3 724 3 1 1 201 399 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 139 ] 143 - c - - - + ML 725 724 3 727 3 1 1 200 398 -11.101 -0.417 -1.998 -0.494 0.732 -0.960 0.157 + D 726 724 3 727 3 0 0 189 387 -9.524 -5.037 -0.047 + IL 727 727 3 727 3 1 1 202 400 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 140 ] 144 - U - - - + ML 728 727 3 730 3 1 1 201 399 -10.688 -0.003 -9.342 -0.062 -0.828 -1.162 1.023 + D 729 727 3 730 3 0 0 189 386 -11.104 -6.617 -0.015 + IL 730 730 3 730 3 1 1 201 399 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 141 ] 145 - A - - - + ML 731 730 3 733 3 1 1 200 398 -0.612 -2.130 -3.094 1.279 -0.407 -1.431 -1.157 + D 732 730 3 733 3 0 0 188 386 -2.082 -1.890 -1.017 + IL 733 733 3 733 3 1 1 204 402 -0.134 -4.164 -4.914 0.000 0.000 0.000 0.000 + [ MATL 142 ] 316 - u - - - + ML 734 733 3 736 3 1 1 66 106 -10.423 -0.075 -4.315 -0.208 -0.233 -0.628 0.710 + D 735 733 3 736 3 0 0 64 103 -11.522 -2.366 -0.312 + IL 736 736 3 736 3 1 1 67 107 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 143 ] 317 - u - - - + ML 737 736 3 739 3 1 1 66 105 -10.562 -0.003 -9.216 -0.559 -0.154 -0.345 0.709 + D 738 736 3 739 3 0 0 63 103 -11.327 -1.843 -0.472 + IL 739 739 3 739 3 1 1 66 106 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 144 ] 318 - u - - - + ML 740 739 3 742 3 1 1 65 104 -10.790 -0.020 -6.243 0.324 -0.573 -0.814 0.592 + D 741 739 3 742 3 0 0 62 102 -10.874 -3.152 -0.173 + IL 742 742 3 742 3 1 1 65 105 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 145 ] 319 - c - - - + ML 743 742 3 745 3 1 1 64 103 -10.830 -0.003 -9.484 -0.145 0.802 -0.921 -0.280 + D 744 742 3 745 3 0 0 62 101 -10.768 -0.629 -1.502 + IL 745 745 3 745 3 1 1 64 104 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 146 ] 320 - g - - - + ML 746 745 3 748 3 1 1 63 102 -11.125 -0.002 -9.779 -1.489 -0.036 0.904 -0.326 + D 747 745 3 748 3 0 0 60 99 -9.319 -1.440 -0.667 + IL 748 748 3 748 3 1 1 63 103 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 147 ] 321 - c - - - + ML 749 748 3 751 5 1 1 62 101 -10.131 -0.321 -2.358 -8.330 -11.050 -1.004 0.929 -0.238 -0.415 + D 750 748 3 751 5 0 0 58 97 -6.869 -2.712 -3.688 -3.502 -0.571 + IL 751 751 3 751 5 1 1 62 101 -2.408 -0.496 -4.087 -5.920 -5.193 0.000 0.000 0.000 0.000 + [ MATP 148 ] 322 405 u a - - + MP 752 751 3 756 6 2 2 61 100 -10.970 -10.909 -0.046 -5.245 -8.198 -10.361 0.126 -1.213 -0.245 0.540 -1.473 -1.390 1.206 -0.052 -2.532 0.620 -3.398 -1.113 1.645 0.077 0.209 -0.830 + ML 753 751 3 756 6 1 1 59 99 -9.739 -10.085 -1.020 -1.006 -9.935 -7.464 -0.399 0.664 -1.237 0.302 + MR 754 751 3 756 6 1 1 59 98 -7.311 -6.040 -1.121 -6.018 -1.152 -4.232 0.883 -0.757 -0.489 -0.233 + D 755 751 3 756 6 0 0 54 94 -11.100 -9.799 -5.596 -6.278 -2.951 -0.259 + IL 756 756 5 756 6 1 1 60 100 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 757 757 6 757 5 1 1 60 99 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 149 ] 323 404 c g - - + MP 758 757 6 762 6 2 2 59 98 -11.087 -11.027 -0.051 -5.034 -8.679 -10.478 -2.364 -2.336 -2.229 0.995 -1.602 -2.502 1.531 -0.987 -1.557 0.929 -1.616 -0.548 1.528 -0.624 1.130 -0.932 + ML 759 757 6 762 6 1 1 57 97 -9.120 -9.466 -0.955 -1.088 -9.316 -6.845 -0.126 0.276 -1.350 0.566 + MR 760 757 6 762 6 1 1 57 96 -7.504 -6.233 -2.142 -6.212 -0.526 -4.425 -0.115 0.359 -0.821 0.296 + D 761 757 6 762 6 0 0 53 92 -10.922 -9.620 -5.417 -2.694 -6.117 -0.311 + IL 762 762 5 762 6 1 1 58 98 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 763 763 6 763 5 1 1 58 97 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 150 ] 324 403 u a - - + MP 764 763 6 768 6 2 2 57 96 -11.135 -11.074 -0.049 -5.233 -7.661 -10.525 -1.673 -1.791 -2.881 0.458 -1.531 -2.920 1.371 -2.369 -1.613 0.916 -3.522 -0.024 2.146 -0.858 0.244 0.244 + ML 765 763 6 768 6 1 1 56 95 -8.807 -9.153 -0.706 -1.434 -9.003 -6.532 0.115 -0.408 -0.092 0.293 + MR 766 763 6 768 6 1 1 55 94 -7.573 -6.301 -1.931 -6.280 -0.594 -4.493 0.306 0.135 -0.688 0.063 + D 767 763 6 768 6 0 0 49 89 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 768 768 5 768 6 1 1 56 96 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 769 769 6 769 5 1 1 56 95 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 151 ] 325 402 a u - - + MP 770 769 6 774 6 2 2 55 94 -11.179 -11.118 -0.211 -7.783 -2.943 -10.569 -0.587 -0.489 -1.215 1.742 -1.042 -1.068 1.442 -1.759 -2.479 0.812 -2.518 -0.672 1.134 -1.329 0.077 -1.046 + ML 771 769 6 774 6 1 1 54 93 -8.272 -8.619 -0.504 -1.994 -5.486 -5.998 -0.201 0.513 -0.773 0.160 + MR 772 769 6 774 6 1 1 53 93 -7.685 -6.414 -1.623 -6.392 -0.723 -4.606 0.637 -0.420 -0.672 0.098 + D 773 769 6 774 6 0 0 48 87 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 774 774 5 774 6 1 1 54 94 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 775 775 6 775 5 1 1 54 94 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 152 ] 326 401 g c - - + MP 776 775 6 780 6 2 2 53 92 -11.051 -10.991 -0.067 -5.080 -6.124 -10.442 -1.864 -2.192 -1.008 1.257 -1.477 -0.642 1.281 -1.088 -2.010 1.813 -3.134 0.323 0.950 -2.959 -0.753 -0.090 + ML 777 775 6 780 6 1 1 52 91 -7.029 -7.376 -0.746 -1.530 -7.225 -4.755 0.211 -0.590 -0.034 0.265 + MR 778 775 6 780 6 1 1 52 91 -9.944 -8.673 -0.200 -8.651 -3.120 -6.865 -0.304 -0.828 -0.987 1.085 + D 779 775 6 780 6 0 0 46 85 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 780 780 5 780 6 1 1 52 92 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 781 781 6 781 5 1 1 52 92 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 153 ] 327 400 g c - - + MP 782 781 6 786 6 2 2 51 90 -11.208 -11.148 -0.019 -7.424 -7.394 -10.599 -2.035 -1.570 -2.937 0.451 -1.472 -1.049 1.936 -2.164 -1.580 2.022 -2.691 0.297 1.053 -2.510 -0.581 -1.609 + ML 783 781 6 786 6 1 1 50 89 -7.600 -7.946 -0.473 -2.053 -7.796 -5.326 -0.507 0.983 -1.081 -0.238 + MR 784 781 6 786 6 1 1 49 89 -7.933 -6.662 -1.066 -6.640 -1.109 -4.853 0.369 -0.479 -0.439 0.326 + D 785 781 6 786 6 0 0 44 84 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 786 786 5 786 6 1 1 50 90 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 787 787 6 787 5 1 1 50 90 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 154 ] 328 399 c g - - + MP 788 787 6 792 6 2 2 49 88 -11.247 -11.186 -0.017 -6.755 -10.243 -10.638 -2.116 -2.274 -2.760 0.725 -1.528 -1.942 2.478 -2.305 -2.154 1.017 -2.858 -1.148 1.745 -2.640 -0.376 -1.949 + ML 789 787 6 792 6 1 1 47 87 -6.725 -7.071 -1.420 -0.848 -6.921 -4.450 0.086 -0.610 0.285 0.090 + MR 790 787 6 792 6 1 1 47 86 -7.650 -6.379 -1.456 -6.357 -0.826 -4.571 -0.173 0.079 -0.873 0.596 + D 791 787 6 792 6 0 0 43 82 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 792 792 5 792 6 1 1 48 88 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 793 793 6 793 5 1 1 48 88 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 155 ] 329 398 g c - - + MP 794 793 6 798 6 2 2 47 86 -11.245 -11.185 -0.050 -5.363 -10.241 -6.980 -2.336 -2.983 -2.041 1.732 -2.136 -2.837 1.540 -2.079 -2.430 1.996 -2.835 -0.346 1.189 -1.931 -0.747 -1.476 + ML 795 793 6 798 6 1 1 46 85 -7.063 -7.409 -2.124 -0.485 -7.259 -4.789 0.049 0.282 -0.803 0.235 + MR 796 793 6 798 6 1 1 45 84 -7.399 -6.128 -2.037 -6.106 -0.575 -4.320 0.034 -0.853 0.688 -0.303 + D 797 793 6 798 6 0 0 42 82 -10.704 -9.402 -5.199 -5.882 -5.899 -0.094 + IL 798 798 5 798 6 1 1 47 86 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 799 799 6 799 5 1 1 46 86 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 156 ] 330 397 c g - - + MP 800 799 6 804 4 2 2 45 84 -1.029 -10.412 -1.287 -3.328 -2.440 -2.632 -2.933 0.502 -1.114 -0.648 2.042 -1.664 -1.821 2.005 -2.185 -0.351 1.149 -2.629 -0.815 -1.618 + ML 801 799 6 804 4 1 1 44 84 -0.787 -5.307 -1.720 -3.447 -0.090 -0.607 0.473 0.023 + MR 802 799 6 804 4 1 1 43 83 -1.731 -4.303 -2.170 -1.231 0.034 -0.853 0.688 -0.303 + D 803 799 6 804 4 0 0 42 82 -1.681 -6.064 -4.080 -0.703 + IL 804 804 5 804 4 1 1 44 84 -0.762 -8.233 -1.335 -6.569 0.000 0.000 0.000 0.000 + IR 805 805 6 805 3 1 1 41 80 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 157 ] 369 - U - - - + ML 806 805 6 808 3 1 1 39 79 -11.062 -0.002 -9.716 -1.007 -0.096 -0.999 1.047 + D 807 805 6 808 3 0 0 38 77 -9.805 -1.005 -0.999 + IL 808 808 3 808 3 1 1 40 79 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 158 ] 370 - U - - - + ML 809 808 3 811 3 1 1 38 78 -11.165 -0.014 -6.724 -1.810 -3.026 -1.805 1.725 + D 810 808 3 811 3 0 0 36 75 -8.880 -1.796 -0.494 + IL 811 811 3 811 3 1 1 39 78 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 159 ] 371 - A - - - + ML 812 811 3 814 3 1 1 38 77 -11.180 -0.097 -3.946 1.496 -1.415 -1.475 -1.171 + D 813 811 3 814 3 0 0 34 73 -8.677 -2.513 -0.282 + IL 814 814 3 814 3 1 1 38 78 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 160 ] 372 - A - - - + ML 815 814 3 817 3 1 1 37 76 -11.097 -0.337 -2.267 1.677 -1.605 -1.874 -2.311 + D 816 814 3 817 3 0 0 32 71 -9.561 -5.074 -0.045 + IL 817 817 3 817 3 1 1 38 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 161 ] 373 - U - - - + ML 818 817 3 820 3 1 1 36 75 -10.763 -0.263 -2.590 -0.154 -1.813 -0.699 1.138 + D 819 817 3 820 3 0 0 32 71 -10.940 -6.453 -0.017 + IL 820 820 3 820 3 1 1 37 76 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 162 ] 374 - a - - - + ML 821 820 3 823 3 1 1 35 74 -0.801 -1.873 -2.707 0.994 -0.353 -1.438 -0.225 + D 822 820 3 823 3 0 0 32 71 -2.506 -2.538 -0.618 + IL 823 823 3 823 3 1 1 36 75 -0.679 -1.858 -3.330 0.000 0.000 0.000 0.000 + [ MATL 163 ] 396 - c - - - + ML 824 823 3 826 2 1 1 1 1 * 0.000 0.458 0.630 -1.297 -0.575 + D 825 823 3 826 2 0 0 0 0 * 0.000 + IL 826 826 3 826 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 164 ] - - - - - - + E 827 826 3 -1 0 0 0 0 0 + [ BEGR 198 ] - - - - - - + S 828 425 1 829 3 2 32 142 178 -11.256 -0.051 -4.877 + IL 829 829 2 829 3 3 33 144 180 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 199 ] 608 - U - - - + ML 830 829 2 832 3 3 32 142 178 -11.208 -0.086 -4.123 -1.644 -0.253 -2.391 1.406 + D 831 829 2 832 3 0 29 139 175 -8.170 -3.683 -0.122 + IL 832 832 3 832 3 3 32 143 179 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 200 ] 609 - C - - - + ML 833 832 3 835 3 2 31 142 177 -11.124 -0.265 -2.581 -0.330 1.208 -1.524 -0.871 + D 834 832 3 835 3 0 29 139 174 -9.331 -4.844 -0.053 + IL 835 835 3 835 3 3 32 143 178 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 201 ] 610 - A - - - + ML 836 835 3 838 3 2 31 141 177 -10.862 -0.179 -3.106 1.574 -1.998 -1.272 -1.479 + D 837 835 3 838 3 0 29 139 174 -10.674 -6.187 -0.021 + IL 838 838 3 838 3 3 31 142 178 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 202 ] 611 - a - - - + ML 839 838 3 841 3 1 30 140 176 -1.081 -2.142 -1.733 0.798 -1.054 -1.054 0.376 + D 840 838 3 841 3 0 29 138 174 -1.555 -1.790 -1.432 + IL 841 841 3 841 3 2 31 140 176 -1.234 -1.162 -2.965 0.000 0.000 0.000 0.000 + [ MATL 203 ] 616 - c - - - + ML 842 841 3 844 3 4 30 138 174 -10.472 -0.009 -7.533 -0.159 0.517 -1.862 0.483 + D 843 841 3 844 3 0 27 136 172 -11.458 -1.894 -0.453 + IL 844 844 3 844 3 2 30 139 174 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 204 ] 617 - u - - - + ML 845 844 3 847 3 4 29 137 173 -10.723 -0.003 -9.377 -0.149 0.290 -1.334 0.565 + D 846 844 3 847 3 0 26 135 171 -11.031 -0.751 -1.302 + IL 847 847 3 847 3 2 29 138 173 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 205 ] 618 - u - - - + ML 848 847 3 850 3 3 28 136 172 -11.068 -0.006 -8.137 0.449 -0.407 -1.511 0.614 + D 849 847 3 850 3 0 25 134 170 -9.768 -1.627 -0.567 + IL 850 850 3 850 3 2 28 137 172 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 206 ] 619 - a - - - + ML 851 850 3 853 3 3 27 135 171 -11.128 -0.002 -9.782 0.922 -1.021 -0.956 0.134 + D 852 850 3 853 3 0 24 133 169 -9.289 -0.703 -1.380 + IL 853 853 3 853 3 1 27 136 171 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 207 ] 620 - A - - - + ML 854 853 3 856 3 2 26 134 170 -11.213 -0.002 -9.867 1.265 -0.727 -1.635 -0.576 + D 855 853 3 856 3 0 23 132 167 -8.044 -1.804 -0.494 + IL 856 856 3 856 3 1 26 135 170 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 208 ] 621 - a - - - + ML 857 856 3 859 3 1 25 133 169 -11.225 -0.268 -2.562 0.492 -0.460 0.368 -0.796 + D 858 856 3 859 3 0 22 131 167 -7.719 -3.232 -0.170 + IL 859 859 3 859 3 1 26 134 170 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 209 ] 622 - u - - - + ML 860 859 3 862 3 1 25 132 168 -10.959 -0.007 -7.898 0.062 0.149 -0.954 0.413 + D 861 859 3 862 3 0 22 131 167 -10.331 -0.228 -2.782 + IL 862 862 3 862 3 1 24 133 169 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 210 ] 623 - g - - - + ML 863 862 3 865 3 1 24 131 167 -11.222 -0.006 -8.092 0.018 -1.058 0.992 -0.950 + D 864 862 3 865 3 0 19 128 164 -7.822 -2.576 -0.272 + IL 865 865 3 865 3 1 23 132 168 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 211 ] 624 - G - - - + ML 866 865 3 868 3 2 23 130 166 -11.221 -0.002 -9.875 0.391 -2.933 1.153 -1.584 + D 867 865 3 868 3 0 19 127 162 -7.829 -3.342 -0.157 + IL 868 868 3 868 3 1 23 131 167 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 212 ] 625 - G - - - + ML 869 868 3 871 3 1 22 129 165 -11.221 -0.061 -4.612 -0.381 -2.108 1.440 -1.802 + D 870 868 3 871 3 0 19 126 162 -7.829 -3.342 -0.157 + IL 871 871 3 871 3 1 22 130 166 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 213 ] 626 - a - - - + ML 872 871 3 874 3 1 21 128 164 -11.163 -0.270 -2.554 0.693 0.270 -1.305 -0.372 + D 873 871 3 874 3 0 18 125 161 -8.911 -4.424 -0.072 + IL 874 874 3 874 3 1 22 129 165 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 214 ] 627 - U - - - + ML 875 874 3 877 3 1 20 127 163 -10.895 -0.472 -1.845 -0.697 -1.641 -1.467 1.433 + D 876 874 3 877 3 0 18 125 161 -10.568 -6.081 -0.022 + IL 877 877 3 877 3 1 21 129 164 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 215 ] 628 - a - - - + ML 878 877 3 880 3 1 20 127 162 -1.614 -1.295 -1.911 0.664 0.443 -0.852 -0.994 + D 879 877 3 880 3 0 18 125 161 -2.314 -3.031 -0.564 + IL 880 880 3 880 3 1 20 127 163 -1.104 -0.915 -7.821 0.000 0.000 0.000 0.000 + [ MATL 216 ] 663 - G - - - + ML 881 880 3 883 2 1 19 125 160 -11.020 -0.001 -0.140 -0.603 1.065 -1.548 + D 882 880 3 883 2 0 18 124 159 -10.222 -0.001 + IL 883 883 3 883 2 1 19 125 161 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ BIF 217 ] - - - - - - + B 884 883 3 885 983 0 18 124 159 + [ BEGL 218 ] - - - - - - + S 885 884 1 886 4 0 0 61 93 -0.731 -5.270 -2.084 -2.882 + [ MATP 219 ] 664 725 c g - - + MP 886 885 1 890 6 2 2 62 94 -10.644 -10.583 -0.007 -9.359 -9.639 -10.034 -0.797 -2.542 -1.376 0.629 -0.985 -2.469 2.040 -2.876 -1.855 0.832 -3.166 0.609 1.528 -0.661 -0.461 -1.151 + ML 887 885 1 890 6 1 1 60 92 -7.523 -7.870 -1.706 -0.616 -7.719 -5.249 0.402 -0.391 -0.407 0.217 + MR 888 885 1 890 6 1 1 59 92 -10.664 -9.393 -3.634 -9.372 -0.135 -7.585 1.666 -1.580 -2.244 -1.827 + D 889 885 1 890 6 0 0 58 90 -12.499 -11.197 -1.795 -1.630 -4.650 -1.521 + IL 890 890 5 890 6 1 1 61 93 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 891 891 6 891 5 1 1 61 93 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 220 ] 665 724 c g - - + MP 892 891 6 896 6 2 2 60 92 -10.771 -10.710 -0.010 -9.487 -9.766 -8.313 -1.800 -2.645 -1.761 0.444 -2.341 -2.186 2.223 -0.486 -1.622 0.231 -2.871 -0.836 2.117 -2.770 0.129 -1.619 + ML 893 891 6 896 6 1 1 58 90 -8.516 -8.862 -2.750 -0.267 -8.712 -6.241 -1.013 -0.079 -1.780 1.181 + MR 894 891 6 896 6 1 1 58 91 -10.613 -9.342 -0.930 -9.320 -1.102 -7.534 -0.745 -1.657 -0.802 1.329 + D 895 891 6 896 6 0 0 55 87 -11.051 -9.749 -4.047 -2.580 -4.322 -0.473 + IL 896 896 5 896 6 1 1 59 91 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 897 897 6 897 5 1 1 59 91 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 221 ] 666 723 g c - - + MP 898 897 6 902 6 2 2 58 90 -11.005 -10.944 -0.010 -7.949 -10.001 -10.396 -1.881 -2.139 -1.343 0.993 -1.853 -2.765 1.291 -3.136 -1.436 1.695 -0.654 0.574 1.495 -2.579 0.230 -2.056 + ML 899 897 6 902 6 1 1 56 89 -8.567 -8.913 -0.386 -2.219 -8.763 -6.292 0.867 -0.579 -0.531 -0.295 + MR 900 897 6 902 6 1 1 57 89 -9.640 -8.369 -0.188 -8.347 -3.260 -6.561 -1.021 -0.182 -1.376 1.164 + D 901 897 6 902 6 0 0 54 86 -10.730 -9.428 -1.917 -5.908 -5.925 -0.514 + IL 902 902 5 902 6 1 1 57 89 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 903 903 6 903 5 1 1 57 89 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 222 ] 667 722 c g - - + MP 904 903 6 908 6 2 2 56 88 -11.267 -11.206 -0.010 -8.527 -8.626 -10.657 -2.094 -2.576 -2.550 1.313 -2.542 -3.452 2.082 -2.710 -1.132 1.087 -2.085 0.306 1.547 -3.124 -0.096 -1.906 + ML 905 903 6 908 6 1 1 54 86 -7.027 -7.373 -1.306 -0.894 -7.223 -4.752 -0.007 0.176 -0.255 0.053 + MR 906 903 6 908 6 1 1 54 86 -7.116 -5.845 -1.754 -5.824 -0.736 -4.037 0.659 -0.584 -0.287 -0.097 + D 907 903 6 908 6 0 0 49 82 -10.338 -9.036 -4.833 -5.515 -5.533 -0.122 + IL 908 908 5 908 6 1 1 55 87 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 909 909 6 909 5 1 1 55 87 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 223 ] 668 721 g c - - + MP 910 909 6 914 6 2 2 54 86 -11.269 -11.208 -0.026 -8.256 -6.238 -10.659 -1.149 -3.001 -1.741 1.196 -2.588 -2.843 1.791 -2.468 -2.210 1.919 -2.757 -0.608 1.125 -1.712 0.412 -1.892 + ML 911 909 6 914 6 1 1 52 84 -6.860 -7.206 -1.594 -0.727 -7.056 -4.585 0.410 -0.006 -0.648 0.053 + MR 912 909 6 914 6 1 1 52 84 -7.229 -5.958 -1.867 -5.936 -0.666 -4.150 0.194 -0.480 0.005 0.183 + D 913 909 6 914 6 0 0 47 80 -10.338 -9.036 -4.833 -5.515 -5.533 -0.122 + IL 914 914 5 914 6 1 1 53 85 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 915 915 6 915 5 1 1 53 85 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 224 ] 669 720 c g - - + MP 916 915 6 920 6 2 2 52 84 -11.250 -11.189 -0.011 -8.503 -8.208 -10.640 -2.298 -1.079 -1.799 1.101 -1.850 -2.218 1.800 -2.384 -1.187 1.367 -3.217 -0.782 1.252 -2.637 1.080 -1.472 + ML 917 915 6 920 6 1 1 50 82 -6.891 -7.237 -1.952 -0.560 -7.087 -4.617 0.054 0.010 -0.138 0.064 + MR 918 915 6 920 6 1 1 50 82 -7.855 -6.584 -0.790 -6.562 -1.475 -4.776 -0.042 -0.367 -0.860 0.767 + D 919 915 6 920 6 0 0 46 78 -10.338 -9.036 -4.833 -5.515 -5.533 -0.122 + IL 920 920 5 920 6 1 1 51 83 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 921 921 6 921 5 1 1 51 83 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 225 ] 670 719 a u - - + MP 922 921 6 926 6 2 2 50 82 -11.264 -11.203 -0.053 -6.132 -6.562 -6.614 -1.684 -2.997 -2.024 1.716 -1.478 -3.388 1.234 -2.111 0.972 0.969 -3.130 -0.398 1.349 -2.225 0.031 -1.255 + ML 923 921 6 926 6 1 1 48 80 -6.983 -7.330 -2.044 -0.518 -7.179 -4.709 0.459 -0.437 -0.131 -0.039 + MR 924 921 6 926 6 1 1 48 80 -7.279 -6.008 -1.429 -5.986 -0.899 -4.200 0.526 -0.516 -0.452 0.176 + D 925 921 6 926 6 0 0 44 76 -10.338 -9.036 -4.833 -5.515 -5.533 -0.122 + IL 926 926 5 926 6 1 1 49 81 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 927 927 6 927 5 1 1 49 81 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 226 ] 671 718 a u - - + MP 928 927 6 932 6 2 2 48 80 -11.220 -11.159 -0.466 -6.193 -2.412 -3.761 -1.954 -1.637 -1.944 1.399 -1.372 -1.214 1.335 -1.990 1.178 1.250 -3.150 -0.714 1.110 -2.087 -0.242 -1.608 + ML 929 927 6 932 6 1 1 46 79 -7.542 -7.889 -1.722 -1.211 -7.738 -1.995 0.626 -0.721 -0.468 0.173 + MR 930 927 6 932 6 1 1 46 78 -7.663 -6.391 -2.300 -6.370 -0.712 -2.666 0.036 -0.281 -0.763 0.644 + D 931 927 6 932 6 0 0 43 76 -10.712 -9.411 -5.208 -5.890 -5.907 -0.093 + IL 932 932 5 932 6 1 1 48 80 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 933 933 6 933 5 1 1 47 80 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 227 ] 672 717 c g - - + MP 934 933 6 938 4 2 2 46 78 -9.690 -9.897 -0.102 -3.923 -1.934 -1.685 -1.957 1.251 -1.084 -3.466 1.612 -2.132 -2.682 1.282 -2.066 -1.006 1.575 -2.149 0.725 -0.392 + ML 935 933 6 938 4 1 1 45 78 -4.728 -4.910 -0.360 -2.737 -0.021 -0.270 -0.368 0.495 + MR 936 933 6 938 4 1 1 44 76 -8.423 -7.452 -4.459 -0.080 -0.865 -1.270 1.419 -1.461 + D 937 933 6 938 4 0 0 43 75 -7.728 -7.410 -4.678 -0.073 + IL 938 938 5 938 4 1 1 47 79 -1.686 -2.369 -1.117 -4.855 0.000 0.000 0.000 0.000 + IR 939 939 6 939 3 1 1 46 78 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 228 ] 673 - u - - - + ML 940 939 6 942 3 1 1 44 76 -0.819 -3.691 -1.491 -0.306 -0.045 0.091 0.210 + D 941 939 6 942 3 0 0 43 75 -2.626 -1.161 -1.355 + IL 942 942 3 942 3 1 1 44 76 -4.834 -0.454 -2.090 0.000 0.000 0.000 0.000 + [ MATL 229 ] 675 - a - - - + ML 943 942 3 945 3 1 1 43 76 -10.338 -0.113 -3.747 0.738 -0.403 -0.545 -0.168 + D 944 942 3 945 3 0 0 40 73 -11.621 -3.122 -0.177 + IL 945 945 3 945 3 1 1 44 77 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 230 ] 676 - a - - - + ML 946 945 3 948 3 1 1 42 75 -0.340 -3.330 -3.179 0.335 -0.388 -0.415 0.291 + D 947 945 3 948 3 0 0 40 72 -5.716 -1.534 -0.653 + IL 948 948 3 948 3 1 1 42 74 -4.894 -0.358 -2.425 0.000 0.000 0.000 0.000 + [ MATL 231 ] 678 - c - - - + ML 949 948 3 951 3 1 1 41 73 -0.721 -1.353 -9.083 -1.127 0.854 -1.097 0.341 + D 950 948 3 951 3 0 0 38 70 -11.514 -0.816 -1.212 + IL 951 951 3 951 3 1 1 40 73 -2.009 -0.422 -7.624 0.000 0.000 0.000 0.000 + [ MATL 232 ] 683 - c - - - + ML 952 951 3 954 3 1 1 39 71 -10.960 -0.119 -3.668 -0.667 0.778 -0.849 0.138 + D 953 951 3 954 3 0 0 37 69 -10.328 -1.549 -0.605 + IL 954 954 3 954 3 1 1 40 72 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 233 ] 684 - g - - - + ML 955 954 3 957 3 1 1 38 70 -10.961 -0.003 -9.615 -0.541 -0.761 0.604 0.266 + D 956 954 3 957 3 0 0 36 69 -10.323 -0.965 -1.039 + IL 957 957 3 957 3 1 1 39 71 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 234 ] 685 - g - - - + ML 958 957 3 960 3 1 1 37 69 -11.123 -0.002 -9.777 -1.605 -0.387 0.872 0.105 + D 959 957 3 960 3 0 0 35 67 -9.338 -0.675 -1.426 + IL 960 960 3 960 3 1 1 38 70 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 235 ] 686 - c - - - + ML 961 960 3 963 3 1 1 36 68 -11.213 -0.005 -8.247 -1.990 0.751 -0.589 0.486 + D 962 960 3 963 3 0 0 33 65 -8.045 -2.950 -0.206 + IL 963 963 3 963 3 1 1 37 69 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 236 ] 687 - u - - - + ML 964 963 3 966 3 1 1 35 67 -11.212 -0.007 -7.812 -1.892 0.723 -1.263 0.734 + D 965 963 3 966 3 0 0 31 64 -8.058 -2.867 -0.219 + IL 966 966 3 966 3 1 1 36 68 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 237 ] 688 - u - - - + ML 967 966 3 969 3 1 1 34 66 -11.211 -0.002 -9.865 -0.453 -0.336 0.277 0.340 + D 968 966 3 969 3 0 0 30 62 -8.097 -3.610 -0.129 + IL 969 969 3 969 3 1 1 35 67 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 238 ] 689 - g - - - + ML 970 969 3 972 3 1 1 33 65 -11.211 -0.762 -1.287 -0.357 0.030 0.352 -0.118 + D 971 969 3 972 3 0 0 29 62 -8.097 -2.945 -0.207 + IL 972 972 3 972 3 1 1 35 67 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 239 ] 690 - g - - - + ML 973 972 3 975 3 1 1 33 65 -0.447 -1.918 -9.112 -0.549 -0.624 0.950 -0.442 + D 974 972 3 975 3 0 0 19 51 -11.477 -1.193 -0.831 + IL 975 975 3 975 3 1 1 32 65 -0.823 -1.210 -8.697 0.000 0.000 0.000 0.000 + [ MATL 240 ] 712 - g - - - + ML 976 975 3 978 3 1 1 19 38 -0.351 -2.717 -3.973 -0.081 -0.844 0.440 0.190 + D 977 975 3 978 3 0 0 17 36 -1.570 -3.316 -0.830 + IL 978 978 3 978 3 1 1 18 37 -1.398 -1.233 -2.359 0.000 0.000 0.000 0.000 + [ MATL 241 ] 716 - g - - - + ML 979 978 3 981 2 1 1 1 1 * 0.000 -0.187 -0.491 0.615 -0.187 + D 980 978 3 981 2 0 0 0 0 * 0.000 + IL 981 981 3 981 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 242 ] - - - - - - + E 982 981 3 -1 0 0 0 0 0 + [ BEGR 243 ] - - - - - - + S 983 884 1 984 3 0 1 87 122 -11.256 -0.284 -2.487 + IL 984 984 2 984 3 1 4 89 124 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 244 ] 726 - A - - - + ML 985 984 2 987 3 1 4 87 122 -10.974 -0.020 -6.209 1.173 -1.954 -0.261 -0.615 + D 986 984 2 987 3 0 0 84 118 -10.267 -5.780 -0.028 + IL 987 987 3 987 3 1 3 88 123 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 245 ] 727 - A - - - + ML 988 987 3 990 3 1 3 87 121 -8.281 -0.082 -4.269 1.706 -3.646 -1.648 -1.562 + D 989 987 3 990 3 0 0 84 118 -10.342 -5.855 -0.026 + IL 990 990 3 990 3 1 3 87 122 -1.512 -0.748 -4.212 0.000 0.000 0.000 0.000 + [ MATL 246 ] 729 - a - - - + ML 991 990 3 993 3 1 2 86 120 -10.882 -0.127 -3.579 0.751 -0.748 -0.038 -0.421 + D 992 990 3 993 3 0 0 84 118 -10.614 -3.052 -0.186 + IL 993 993 3 993 3 1 2 87 121 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 247 ] 730 - a - - - + ML 994 993 3 996 3 1 1 85 119 -10.809 -0.728 -1.338 0.935 -0.401 -0.725 -0.464 + D 995 993 3 996 3 0 0 84 118 -10.826 -0.800 -1.234 + IL 996 996 3 996 3 1 3 86 121 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 248 ] 731 - a - - - + ML 997 996 3 999 3 1 2 84 119 -0.852 -1.170 -9.174 0.472 -0.899 0.258 -0.183 + D 998 996 3 999 3 0 0 81 116 -11.391 -1.500 -0.630 + IL 999 999 3 999 3 1 2 84 118 -1.419 -0.686 -7.851 0.000 0.000 0.000 0.000 + [ MATL 249 ] 735 - u - - - + ML 1000 999 3 1002 3 1 1 82 116 -10.826 -0.382 -2.108 0.384 0.046 -2.097 0.515 + D 1001 999 3 1002 3 0 0 81 115 -10.780 -0.444 -1.918 + IL 1002 1002 3 1002 3 1 1 83 117 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 250 ] 736 - u - - - + ML 1003 1002 3 1005 3 1 2 81 116 -10.870 -0.007 -7.916 -0.132 -0.281 -1.072 0.839 + D 1004 1002 3 1005 3 0 0 80 114 -10.651 -0.416 -2.000 + IL 1005 1005 3 1005 3 1 1 82 116 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 251 ] 737 - a - - - + ML 1006 1005 3 1008 3 1 1 80 115 -11.173 -0.014 -6.805 0.892 -1.251 -1.651 0.492 + D 1007 1005 3 1008 3 0 0 78 112 -8.779 -2.044 -0.405 + IL 1008 1008 3 1008 3 1 1 81 115 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 252 ] 738 - A - - - + ML 1009 1008 3 1011 3 1 3 79 114 -11.181 -0.002 -9.835 1.025 -0.688 -1.490 -0.017 + D 1010 1008 3 1011 3 0 0 77 111 -8.657 -1.447 -0.665 + IL 1011 1011 3 1011 3 1 1 80 114 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 253 ] 739 - a - - - + ML 1012 1011 3 1014 3 1 2 78 113 -11.210 -0.002 -9.864 0.372 -0.544 -0.419 0.348 + D 1013 1011 3 1014 3 0 0 75 109 -8.119 -2.873 -0.218 + IL 1014 1014 3 1014 3 1 1 79 113 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 254 ] 740 - a - - - + ML 1015 1014 3 1017 3 1 2 77 112 -11.213 -0.002 -9.867 0.169 -0.036 0.125 -0.304 + D 1016 1014 3 1017 3 0 0 73 108 -8.036 -3.549 -0.135 + IL 1017 1017 3 1017 3 1 1 78 112 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 255 ] 741 - a - - - + ML 1018 1017 3 1020 3 1 2 76 111 -11.213 -0.002 -9.867 0.247 0.206 -0.195 -0.346 + D 1019 1017 3 1020 3 0 0 73 107 -8.036 -3.549 -0.135 + IL 1020 1020 3 1020 3 1 1 77 111 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 256 ] 742 - g - - - + ML 1021 1020 3 1023 3 1 1 75 110 -11.213 -0.006 -8.084 0.699 -1.432 0.771 -1.741 + D 1022 1020 3 1023 3 0 0 72 106 -8.036 -3.549 -0.135 + IL 1023 1023 3 1023 3 1 1 76 110 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 257 ] 743 - g - - - + ML 1024 1023 3 1026 3 1 1 74 109 -11.210 -0.010 -7.195 0.420 -1.046 0.818 -1.270 + D 1025 1023 3 1026 3 0 0 71 106 -8.125 -2.838 -0.223 + IL 1026 1026 3 1026 3 1 1 75 109 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 258 ] 744 - c - - - + ML 1027 1026 3 1029 3 1 1 73 108 -11.205 -0.037 -5.316 -0.023 0.468 -0.327 -0.259 + D 1028 1026 3 1029 3 0 0 70 105 -8.224 -3.737 -0.118 + IL 1029 1029 3 1029 3 1 1 74 108 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 259 ] 745 - u - - - + ML 1030 1029 3 1032 3 1 1 72 107 -11.170 -0.260 -2.603 -0.595 0.249 -1.805 0.898 + D 1031 1029 3 1032 3 0 0 70 104 -8.815 -4.328 -0.077 + IL 1032 1032 3 1032 3 1 1 73 108 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 260 ] 746 - u - - - + ML 1033 1032 3 1035 5 1 1 71 106 -1.627 -0.788 -9.688 -3.529 -6.734 0.184 -0.566 0.024 0.229 + D 1034 1032 3 1035 5 0 0 70 104 -3.071 -1.068 -6.214 -1.815 -3.232 + IL 1035 1035 3 1035 5 1 1 71 105 -2.935 -0.430 -6.062 -9.060 -3.183 0.000 0.000 0.000 0.000 + [ MATP 261 ] 750 802 g c - - + MP 1036 1035 3 1040 6 2 2 70 105 -11.031 -10.970 -0.008 -9.746 -8.430 -10.421 -2.565 -2.480 -1.826 0.607 -3.138 -2.086 0.604 -2.161 -2.430 2.413 -2.431 1.828 0.666 -2.041 -1.053 -2.345 + ML 1037 1035 3 1040 6 1 1 68 102 -6.599 -6.945 -1.660 -0.722 -6.795 -4.325 0.566 -0.683 -0.006 -0.152 + MR 1038 1035 3 1040 6 1 1 68 103 -9.816 -8.545 -1.331 -8.523 -0.769 -6.737 0.748 -0.987 -1.088 0.429 + D 1039 1035 3 1040 6 0 0 62 97 -11.537 -10.235 -6.032 -6.714 -6.732 -0.052 + IL 1040 1040 5 1040 6 1 1 70 104 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1041 1041 6 1041 5 1 1 69 104 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 262 ] 751 801 c g - - + MP 1042 1041 6 1046 6 2 2 68 103 -11.108 -11.047 -0.068 -9.824 -4.535 -10.499 -1.516 -2.136 -1.439 0.176 -2.613 -2.659 2.429 -2.948 -1.479 1.049 -2.108 -1.348 1.296 -2.459 1.118 -2.135 + ML 1043 1041 6 1046 6 1 1 66 101 -6.599 -6.945 -1.660 -0.722 -6.795 -4.325 0.520 -0.249 -0.513 0.033 + MR 1044 1041 6 1046 6 1 1 67 101 -9.217 -7.946 -0.969 -7.924 -1.219 -4.336 0.199 -0.554 -0.510 0.555 + D 1045 1041 6 1046 6 0 0 61 95 -11.537 -10.235 -6.032 -6.714 -6.732 -0.052 + IL 1046 1046 5 1046 6 1 1 68 102 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1047 1047 6 1047 5 1 1 67 102 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 263 ] 752 800 c g - - + MP 1048 1047 6 1052 6 2 2 66 101 -11.112 -11.051 -0.005 -9.827 -10.107 -10.502 -1.112 -2.324 -1.688 1.185 -1.644 -3.717 2.224 -3.217 -1.926 0.603 -3.143 -0.598 1.653 -2.749 0.388 -1.258 + ML 1049 1047 6 1052 6 1 1 64 99 -6.599 -6.945 -1.660 -0.722 -6.795 -4.325 0.025 0.078 -0.659 0.372 + MR 1050 1047 6 1052 6 1 1 65 99 -9.126 -7.855 -0.292 -7.833 -2.663 -6.047 0.542 -0.342 -0.762 0.220 + D 1051 1047 6 1052 6 0 0 60 94 -11.598 -10.296 -4.155 -6.775 -6.793 -0.113 + IL 1052 1052 5 1052 6 1 1 66 100 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1053 1053 6 1053 5 1 1 65 100 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 264 ] 753 799 u a - - + MP 1054 1053 6 1058 6 2 2 64 99 -11.215 -11.154 -0.025 -7.707 -6.543 -10.606 -1.024 -1.980 -1.200 1.271 -2.404 -2.373 1.510 -2.902 -2.350 1.078 -2.116 -0.996 1.964 -0.908 0.282 -1.509 + ML 1055 1053 6 1058 6 1 1 62 97 -6.599 -6.945 -1.660 -0.945 -6.795 -2.871 0.868 -0.744 -0.474 -0.222 + MR 1056 1053 6 1058 6 1 1 63 97 -7.167 -5.895 -1.804 -5.874 -0.704 -4.087 0.242 -0.636 0.341 -0.141 + D 1057 1053 6 1058 6 0 0 58 93 -11.537 -10.235 -6.032 -6.714 -6.732 -0.052 + IL 1058 1058 5 1058 6 1 1 64 98 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1059 1059 6 1059 5 1 1 63 98 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 265 ] 754 798 c g - - + MP 1060 1059 6 1064 6 2 2 62 97 -11.195 -11.134 -0.344 -3.269 -10.191 -3.230 -1.379 -1.793 -1.771 1.337 -2.133 -3.779 1.751 -2.380 -1.360 1.399 -2.784 -0.322 1.434 -1.302 0.308 -1.593 + ML 1061 1059 6 1064 6 1 1 61 95 -6.714 -7.060 -1.156 -1.059 -6.910 -4.439 0.410 -0.492 -0.540 0.347 + MR 1062 1059 6 1064 6 1 1 61 95 -7.687 -6.416 -0.776 -6.394 -1.528 -4.608 -0.229 0.534 -0.951 0.240 + D 1063 1059 6 1064 6 0 0 58 92 -11.572 -10.271 -6.068 -4.888 -6.767 -0.088 + IL 1064 1064 5 1064 6 1 1 62 96 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1065 1065 6 1065 5 1 1 62 96 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 266 ] 755 797 a u - - + MP 1066 1065 6 1070 6 2 2 61 95 -10.887 -10.827 -0.019 -9.603 -6.643 -10.278 -1.966 -1.207 -0.737 1.556 -2.225 -2.108 1.460 -2.361 -1.341 1.073 -2.110 -0.321 1.438 -2.160 0.579 -1.252 + ML 1067 1065 6 1070 6 1 1 58 92 -9.073 -9.419 -2.015 -0.506 -9.269 -4.523 -0.171 -1.363 1.089 -0.747 + MR 1068 1065 6 1070 6 1 1 59 93 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 1069 1065 6 1070 6 0 0 58 92 -12.775 -11.473 -0.779 -7.953 -7.970 -1.290 + IL 1070 1070 5 1070 6 1 1 60 94 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1071 1071 6 1071 5 1 1 60 94 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 267 ] 756 796 u a - - + MP 1072 1071 6 1076 6 2 2 59 93 -11.091 -11.030 -0.066 -6.049 -5.176 -10.482 -1.496 -2.579 -2.170 1.502 -2.370 -3.337 1.511 -2.315 -2.063 1.323 -2.719 -0.759 1.551 -1.353 0.637 -0.474 + ML 1073 1071 6 1076 6 1 1 55 89 -8.706 -9.052 -3.275 -2.870 -8.902 -0.408 -0.933 -0.777 -1.212 1.299 + MR 1074 1071 6 1076 6 1 1 57 91 -7.426 -6.155 -2.064 -6.133 -0.562 -4.347 0.117 -0.202 0.023 0.043 + D 1075 1071 6 1076 6 0 0 53 87 -11.615 -10.313 -6.110 -6.792 -6.809 -0.049 + IL 1076 1076 5 1076 6 1 1 58 92 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1077 1077 6 1077 5 1 1 58 92 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 268 ] 757 795 g c - - + MP 1078 1077 6 1082 6 2 2 57 91 -11.036 -10.975 -0.043 -6.965 -5.662 -10.426 -1.381 -2.118 -2.322 0.982 -2.575 -3.209 1.556 -1.625 -1.486 1.632 -2.481 -0.819 1.350 -2.655 1.156 -0.914 + ML 1079 1077 6 1082 6 1 1 55 90 -7.241 -7.587 -1.896 -0.553 -7.437 -4.966 0.345 -0.581 -0.767 0.560 + MR 1080 1077 6 1082 6 1 1 55 90 -8.353 -7.082 -0.559 -7.061 -2.194 -3.557 0.378 -0.267 -0.201 -0.001 + D 1081 1077 6 1082 6 0 0 52 87 -12.522 -11.220 -7.017 -7.699 -7.717 -0.026 + IL 1082 1082 5 1082 6 1 1 56 90 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1083 1083 6 1083 5 1 1 56 90 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 269 ] 758 794 a u - - + MP 1084 1083 6 1088 6 2 2 55 89 -11.049 -10.988 -0.190 -5.590 -3.342 -8.463 -1.472 -1.667 -1.347 1.956 -1.810 -3.668 1.073 -2.345 -1.057 1.525 -3.088 -0.059 1.048 -1.580 -0.020 -0.825 + ML 1085 1083 6 1088 6 1 1 54 88 -7.389 -7.735 -2.254 -0.712 -7.585 -2.607 0.047 -0.575 -0.592 0.707 + MR 1086 1083 6 1088 6 1 1 53 87 -7.857 -6.586 -2.495 -6.564 -0.732 -2.356 -0.150 -0.391 -0.601 0.745 + D 1087 1083 6 1088 6 0 0 52 87 -12.551 -11.249 -7.046 -1.886 -7.745 -0.481 + IL 1088 1088 5 1088 6 1 1 54 89 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1089 1089 6 1089 5 1 1 54 88 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 270 ] 759 793 u a - - + MP 1090 1089 6 1094 4 2 2 53 87 -1.849 -10.014 -1.735 -1.248 -1.722 -1.216 -1.345 1.115 -1.201 -2.780 0.962 -1.400 -0.222 1.184 -0.783 -0.442 1.266 -0.827 0.694 -0.386 + ML 1091 1089 6 1094 4 1 1 54 88 -0.498 -5.990 -2.225 -4.005 -0.387 0.558 -0.445 0.041 + MR 1092 1089 6 1094 4 1 1 51 85 -2.810 -6.564 -1.185 -1.297 -0.086 -0.009 0.118 -0.031 + D 1093 1089 6 1094 4 0 0 51 86 -1.464 -7.374 -5.389 -0.719 + IL 1094 1094 5 1094 4 1 1 53 87 -0.804 -7.580 -1.248 -10.065 0.000 0.000 0.000 0.000 + IR 1095 1095 6 1095 3 1 1 49 82 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 271 ] 763 - u - - - + ML 1096 1095 6 1098 3 1 1 47 80 -10.515 -0.036 -5.386 0.354 -0.798 -0.429 0.489 + D 1097 1095 6 1098 3 0 0 46 79 -11.398 -0.710 -1.365 + IL 1098 1098 3 1098 3 1 1 48 81 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 272 ] 764 - a - - - + ML 1099 1098 3 1101 3 1 1 46 79 -11.299 -0.375 -2.128 0.516 -0.360 0.075 -0.440 + D 1100 1098 3 1101 3 0 0 45 78 -8.964 -1.933 -0.442 + IL 1101 1101 3 1101 3 1 1 47 80 -1.925 -0.554 -4.164 0.000 0.000 0.000 0.000 + [ MATR 273 ] - 792 - g - - + MR 1102 1101 3 1104 3 1 1 46 79 -1.529 -1.323 -1.979 0.070 -0.868 0.633 -0.231 + D 1103 1101 3 1104 3 0 0 44 77 -1.980 -1.933 -1.045 + IR 1104 1104 3 1104 3 1 1 47 80 -0.805 -1.492 -3.792 0.000 0.000 0.000 0.000 + [ MATR 274 ] - 788 - a - - + MR 1105 1104 3 1107 5 1 1 36 60 -9.527 -0.061 -5.508 -9.554 -5.873 0.584 -0.802 0.139 -0.275 + D 1106 1104 3 1107 5 0 0 35 59 -9.470 -0.332 -5.364 -8.527 -2.495 + IR 1107 1107 3 1107 5 1 1 36 60 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 275 ] 765 787 g c - - + MP 1108 1107 3 1112 6 2 2 35 59 -11.185 -11.124 -0.020 -6.884 -10.180 -8.190 -2.116 -1.159 -2.933 0.334 -1.958 -2.997 1.348 -3.285 -2.430 2.609 -2.001 -0.500 0.992 -2.178 0.024 -1.213 + ML 1109 1107 3 1112 6 1 1 33 57 -7.293 -7.639 -2.353 -0.514 -7.489 -3.521 0.554 -0.640 -0.761 0.379 + MR 1110 1107 3 1112 6 1 1 33 57 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 1111 1107 3 1112 6 0 0 29 53 -11.707 -10.406 -6.203 -6.885 -6.902 -0.046 + IL 1112 1112 5 1112 6 1 1 35 59 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1113 1113 6 1113 5 1 1 35 58 -2.408 -0.496 -5.920 -4.087 -5.193 0.000 0.000 0.000 0.000 + [ MATP 276 ] 766 786 c g - - + MP 1114 1113 6 1118 6 2 2 33 57 -11.170 -9.419 -0.037 -8.067 -6.279 -7.262 -1.824 -2.475 -1.608 0.633 -2.384 -2.303 2.797 -2.464 -1.990 0.907 -1.679 0.252 0.442 -1.797 -0.893 -1.661 + ML 1115 1113 6 1118 6 1 1 31 55 -7.489 -7.835 -1.612 -2.244 -7.685 -1.162 0.122 -0.196 -0.349 0.325 + MR 1116 1113 6 1118 6 1 1 31 55 -6.988 -5.717 -1.625 -5.695 -0.829 -3.908 0.368 -0.385 -0.191 0.094 + D 1117 1113 6 1118 6 0 0 28 52 -11.784 -10.482 -6.279 -6.962 -6.979 -0.044 + IL 1118 1118 5 1118 6 1 1 33 57 -2.579 -2.842 -0.760 -4.497 -5.274 -4.934 0.000 0.000 0.000 0.000 + IR 1119 1119 6 1119 5 1 1 33 56 -2.444 -0.482 -5.955 -4.123 -5.229 0.000 0.000 0.000 0.000 + [ MATP 277 ] 767 784 c g - - + MP 1120 1119 6 1124 4 2 2 31 55 -1.665 -5.008 -0.894 -3.113 -1.936 -2.707 -2.934 -0.068 -0.087 -3.366 2.229 -2.300 -2.236 1.848 -3.573 -1.635 0.915 -1.972 0.912 -1.591 + ML 1121 1119 6 1124 4 1 1 30 53 -3.909 -4.092 -0.658 -2.053 0.140 0.134 -0.537 0.152 + MR 1122 1119 6 1124 4 1 1 29 53 -5.547 -4.576 -1.090 -1.099 -0.008 -0.585 0.098 0.343 + D 1123 1119 6 1124 4 0 0 27 51 -7.542 -4.023 -4.228 -0.185 + IL 1124 1124 5 1124 4 1 1 30 54 -1.683 -5.853 -0.616 -5.735 0.000 0.000 0.000 0.000 + IR 1125 1125 6 1125 3 1 1 30 53 -1.701 -1.598 -1.466 0.000 0.000 0.000 0.000 + [ MATL 278 ] 771 - U - - - + ML 1126 1125 6 1128 3 1 1 28 52 -10.859 -0.003 -9.513 -1.339 -1.839 -0.982 1.495 + D 1127 1125 6 1128 3 0 0 27 51 -10.684 -0.543 -1.677 + IL 1128 1128 3 1128 3 1 1 30 53 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 279 ] 772 - G - - - + ML 1129 1128 3 1131 3 1 1 27 51 -11.149 -0.002 -9.803 -1.706 -2.604 1.627 -1.180 + D 1130 1128 3 1131 3 0 0 24 48 -9.071 -2.923 -0.207 + IL 1131 1131 3 1131 3 1 1 29 52 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 280 ] 773 - u - - - + ML 1132 1131 3 1134 3 1 1 26 50 -11.161 -0.002 -9.815 -1.051 -0.569 -0.245 1.000 + D 1133 1131 3 1134 3 0 0 22 46 -8.935 -4.448 -0.071 + IL 1134 1134 3 1134 3 1 1 28 51 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 281 ] 774 - C - - - + ML 1135 1134 3 1137 3 1 1 25 49 -11.161 -0.007 -7.805 -1.579 1.026 -2.087 0.479 + D 1136 1134 3 1137 3 0 0 21 44 -8.935 -4.448 -0.071 + IL 1137 1137 3 1137 3 1 1 27 50 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 282 ] 775 - c - - - + ML 1138 1137 3 1140 3 1 1 24 48 -0.993 -1.011 -9.810 -0.457 0.411 -0.510 0.309 + D 1139 1137 3 1140 3 0 0 16 40 -8.994 -3.151 -0.176 + IL 1140 1140 3 1140 3 1 1 24 48 -1.115 -0.901 -8.532 0.000 0.000 0.000 0.000 + [ MATL 283 ] 778 - g - - - + ML 1141 1140 3 1143 3 1 1 13 31 -11.164 -0.157 -3.280 -0.591 -0.768 0.860 -0.099 + D 1142 1140 3 1143 3 0 0 12 31 -8.892 -4.019 -0.095 + IL 1143 1143 3 1143 3 1 1 18 37 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 284 ] 779 - U - - - + ML 1144 1143 3 1146 3 1 1 11 29 -11.011 -0.207 -2.910 -1.179 -1.076 -0.558 1.266 + D 1145 1143 3 1146 3 0 0 11 29 -10.094 -5.607 -0.031 + IL 1146 1146 3 1146 3 1 1 18 36 -1.442 -0.798 -4.142 0.000 0.000 0.000 0.000 + [ MATL 285 ] 780 - c - - - + ML 1147 1146 3 1149 2 1 1 1 1 * 0.000 -1.034 0.727 0.133 -0.395 + D 1148 1146 3 1149 2 0 0 0 0 * 0.000 + IL 1149 1149 3 1149 2 1 1 13 28 -1.823 -0.479 0.000 0.000 0.000 0.000 + [ END 286 ] - - - - - - + E 1150 1149 3 -1 0 0 0 0 0 +// +HMMER3/f [3.4 | Aug 2023] +NAME tmRNA +ACC RF00023 +DESC transfer-messenger RNA +LENG 374 +MAXL 657 +ALPH RNA +RF no +MM no +CONS yes +CS yes +MAP yes +DATE Tue Aug 6 09:53:23 2024 +COM [1] /hps/software/users/agb/rfam/bin/cmbuild -F CM SEED +COM [2] /hps/software/users/agb/rfam/bin/cmcalibrate --cpu 8 /nfs/production/agb/rfam/15/rescan/families/RF00023/CM +NSEQ 477 +EFFN 18.483604 +CKSUM 1194545277 +STATS LOCAL MSV -11.5428 0.70340 +STATS LOCAL VITERBI -13.1633 0.70340 +STATS LOCAL FORWARD -4.0206 0.70340 +HMM A C G U + m->m m->i m->d i->m i->i d->m d->d + COMPO 1.34787 1.45474 1.35610 1.38997 + 1.38629 1.38629 1.38629 1.38629 + 0.01218 5.10744 5.10744 1.46634 0.26236 0.00000 * + 1 4.00452 5.03179 0.03223 4.96761 1 G - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01218 5.10744 5.10744 1.46634 0.26236 1.09861 0.40547 + 2 4.03266 5.07587 0.03101 5.02687 2 G - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01218 5.10744 5.10744 1.46634 0.26236 1.09861 0.40547 + 3 3.26723 4.71832 0.06088 4.42081 3 G - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01211 5.11314 5.11314 1.46634 0.26236 1.09861 0.40547 + 4 3.50236 4.35467 0.06460 3.93304 4 G - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11451 5.11451 1.46634 0.26236 1.09861 0.40547 + 5 1.60110 1.28181 0.97880 1.93082 5 g - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11451 5.11451 1.46634 0.26236 1.09861 0.40547 + 6 3.43379 0.79756 3.46380 0.72155 6 u - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11451 5.11451 1.46634 0.26236 1.09861 0.40547 + 7 3.99973 5.02397 0.03710 4.46381 7 G - - [ + 1.38629 1.38629 1.38629 1.38629 + 0.03194 5.11704 3.67138 1.46634 0.26236 1.09861 0.40547 + 8 0.68009 2.22082 2.87215 1.11374 8 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.14630 5.09740 2.04032 1.46634 0.26236 0.49050 0.94757 + 9 1.49332 1.59219 2.09559 0.80096 9 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.40226 1.43797 2.36674 0.06253 2.80326 0.10782 2.28074 + 10 1.16874 1.13414 2.61652 1.22253 12 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01827 5.12072 4.41149 1.46634 0.26236 2.85895 0.05904 + 11 1.65337 1.27935 2.71784 0.76709 13 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11454 5.11454 1.46634 0.26236 2.20723 0.11654 + 12 4.74812 5.87596 0.01681 5.25940 14 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01202 5.12072 5.12072 1.46634 0.26236 2.85895 0.05904 + 13 3.68620 4.27660 0.05744 4.08262 15 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01202 5.12072 5.12072 1.46634 0.26236 2.85895 0.05904 + 14 0.95477 1.85859 2.44450 0.98769 16 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01202 5.12072 5.12072 1.46634 0.26236 2.85895 0.05904 + 15 2.85295 3.20794 4.13867 0.12110 17 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.02011 5.12072 4.27310 1.46634 0.26236 1.33330 0.30599 + 16 3.52709 3.24367 3.43054 0.10623 18 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.07494 3.46274 3.19764 0.41872 1.07262 1.87230 0.16696 + 17 4.58958 0.08093 5.02134 2.79703 21 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01830 5.12072 4.40938 1.46634 0.26236 2.98967 0.05161 + 18 3.62475 3.74015 0.07363 3.88369 22 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11451 5.11451 1.46634 0.26236 0.56790 0.83636 + 19 0.08385 3.60172 3.51489 3.75482 23 A - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01124 5.18665 5.18665 1.46634 0.26236 1.95751 0.15223 + 20 5.27474 0.02195 5.46637 4.39306 24 C - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01118 5.19231 5.19231 1.46634 0.26236 0.49073 0.94721 + 21 1.12974 3.01979 0.68222 2.09900 25 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01760 5.25277 4.40515 1.46634 0.26236 0.84453 0.56169 + 22 1.95353 1.83168 0.80719 1.37844 26 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01384 5.25630 4.76410 1.46634 0.26236 0.50600 0.92358 + 23 1.83975 1.71062 0.61110 2.14019 27 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01038 5.26619 5.26619 1.46634 0.26236 0.79866 0.59771 + 24 1.36177 2.02207 0.82802 1.74582 28 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01015 5.28896 5.28896 1.46634 0.26236 1.09861 0.40547 + 25 1.35420 1.89147 1.27587 1.16537 29 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01306 5.28896 4.83704 1.46634 0.26236 1.09861 0.40547 + 26 1.70551 1.83729 1.66633 0.75474 30 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.03828 5.28607 3.42678 1.46634 0.26236 0.82101 0.57979 + 27 1.49617 1.40875 1.54007 1.14823 31 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.04625 5.26123 3.21866 1.46634 0.26236 1.94081 0.15500 + 28 1.39320 1.66466 1.10682 1.46163 32 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.15447 5.22691 1.98224 1.46634 0.26236 2.70275 0.06937 + 29 1.78391 1.16565 1.54784 1.17897 33 c - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.17220 5.08872 1.88370 1.46634 0.26236 3.67817 0.02559 + 30 1.32681 2.60204 0.72991 1.72259 34 g - - - + 1.38629 1.38629 1.38629 1.38629 + 0.18042 4.93106 1.84602 1.46634 0.26236 0.95808 0.48391 + 31 0.30168 2.72623 2.31076 2.34578 35 A - - - + 1.38629 1.38629 1.38629 1.38629 + 0.81896 1.95213 0.87434 0.43350 1.04480 0.36938 1.17494 + 32 1.05995 1.74002 1.84744 1.13828 42 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.23363 4.82519 1.60783 1.46634 0.26236 0.88648 0.53120 + 33 1.38824 1.40413 1.37099 1.38210 43 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.02424 4.88083 4.11278 1.46634 0.26236 0.04848 3.05081 + 34 1.01479 1.91902 1.28454 1.54182 44 a - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01904 4.82284 4.52630 0.98897 0.46515 0.93728 0.49707 + 35 1.16401 1.36730 1.48366 1.57907 46 a - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01392 5.28323 4.73919 1.46634 0.26236 1.27342 0.32833 + 36 1.76115 1.21063 1.27174 1.38709 47 c - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.02574 5.28227 3.89555 1.46634 0.26236 1.73495 0.19408 + 37 1.85651 0.95272 1.61133 1.35297 48 c - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.07636 5.26690 2.68299 1.46634 0.26236 0.60711 0.78729 + 38 1.37885 1.29638 1.74336 1.20503 49 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.20288 5.22192 1.72471 1.46634 0.26236 1.42541 0.27498 + 39 1.28955 1.77482 1.57926 1.05279 50 u - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.29817 5.05242 1.38058 1.46634 0.26236 0.60266 0.79265 + 40 1.42713 1.73896 1.06933 1.42271 51 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01689 4.95794 4.63399 1.46634 0.26236 1.98486 0.14780 + 41 1.36817 1.77240 1.23285 1.25863 52 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01350 5.00521 5.00521 1.46634 0.26236 0.06769 2.72647 + 42 1.12584 1.95259 1.16767 1.50227 54 a - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.02004 5.28825 4.21349 1.46634 0.26236 0.87558 0.53892 + 43 1.37925 1.79873 1.21051 1.25639 55 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01021 5.28289 5.28289 1.46634 0.26236 0.96902 0.47715 + 44 1.41817 2.01253 1.14359 1.18574 56 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.04400 5.28848 3.27018 1.46634 0.26236 1.00981 0.45301 + 45 1.92493 1.97878 0.84849 1.24543 57 g - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.34433 1.26273 4.77677 0.03640 3.33133 0.21473 1.64381 + 46 4.85318 0.05725 4.01228 3.51507 59 C - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 47 0.59785 3.15009 0.97908 3.45778 60 A - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 48 1.76975 1.96538 1.78324 0.65118 61 U - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 49 2.24387 2.64135 0.29925 2.50948 62 G - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 50 3.15780 0.65989 2.74658 0.97704 63 C - - ( + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 51 2.79487 0.17543 2.94177 3.05733 64 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 52 2.72891 3.91957 0.10642 4.14671 65 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 53 0.49163 2.73488 1.80429 1.83961 66 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 1.28603 0.32347 + 54 2.28617 2.85029 0.28602 2.41609 67 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.05088 5.29263 3.11046 1.46634 0.26236 1.28603 0.32347 + 55 1.88276 2.32386 0.48446 2.01063 68 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.41391 1.25286 2.93270 0.56995 0.83369 0.34384 1.23458 + 56 1.57916 1.66608 1.08869 1.31600 74 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01064 5.24160 5.24160 1.46634 0.26236 0.43034 1.05064 + 57 1.80905 1.53741 1.05932 1.29258 75 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01022 5.28198 5.28198 1.46634 0.26236 0.85944 0.55061 + 58 1.72829 1.09183 1.46438 1.36418 76 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02522 5.28919 3.91889 1.46634 0.26236 1.45894 0.26460 + 59 1.37658 1.61070 1.05107 1.61823 77 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06393 5.27427 2.86804 1.46634 0.26236 1.39667 0.28425 + 60 1.81129 1.33991 0.93278 1.70800 78 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.04934 5.22545 3.15201 1.46634 0.26236 2.80573 0.06237 + 61 1.58821 1.58101 1.51500 0.99389 79 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.11309 5.18735 2.28921 1.46634 0.26236 3.15663 0.04350 + 62 1.51210 1.57698 1.41941 1.10533 80 u - - < + 1.38629 1.38629 1.38629 1.38629 + 1.05893 0.57847 2.38147 0.53781 0.87713 1.69716 0.20237 + 63 1.41853 1.66074 0.89719 1.83122 87 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01304 5.03915 5.03915 1.46634 0.26236 0.32802 1.27422 + 64 1.92648 0.62239 2.31898 1.51728 88 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01069 5.23655 5.23655 1.46634 0.26236 0.29331 1.36961 + 65 2.32564 0.36393 2.77823 1.92969 89 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01016 5.28730 5.28730 1.46634 0.26236 0.82068 0.58005 + 66 1.90771 2.00513 2.73905 0.42724 90 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01011 5.29263 5.29263 1.46634 0.26236 0.80460 0.59288 + 67 3.77783 0.13222 4.13412 2.46554 91 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 68 3.02262 2.95180 0.20262 2.49508 92 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01685 5.29574 4.44812 1.46634 0.26236 1.09861 0.40547 + 69 2.62844 2.91065 3.77564 0.16199 93 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01370 5.28903 4.76031 1.46634 0.26236 1.46651 0.26231 + 70 0.59579 2.50619 2.65459 1.21414 94 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01210 5.28551 4.96717 1.46634 0.26236 1.61559 0.22161 + 71 0.07850 3.58850 3.93437 3.56489 95 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.07278 5.28361 2.73153 1.46634 0.26236 1.68745 0.20456 + 72 0.21570 3.28710 2.74617 2.38065 96 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.30771 5.22168 1.34910 1.46634 0.26236 2.84720 0.05976 + 73 1.19645 1.34729 2.72482 0.98824 97 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.88114 0.62283 3.01054 0.91987 0.50844 0.48898 0.94999 + 74 0.57938 1.71741 2.09122 1.99005 105 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.06790 5.14054 2.81682 1.46634 0.26236 0.98679 0.46645 + 75 0.97202 1.57666 1.50499 1.64507 106 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01167 5.14983 5.14983 1.46634 0.26236 0.59679 0.79979 + 76 1.22063 1.80460 1.14125 1.50961 107 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01070 5.23626 5.23626 1.46634 0.26236 0.83232 0.57100 + 77 1.79326 1.07698 1.30180 1.50995 108 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01040 5.26415 5.26415 1.46634 0.26236 0.59869 0.79746 + 78 1.82517 1.13023 1.44966 1.26868 109 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01325 5.28492 4.81618 1.46634 0.26236 0.49212 0.94502 + 79 1.58666 1.67564 0.90941 1.58259 110 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01691 5.29274 4.44512 1.46634 0.26236 1.28038 0.32564 + 80 1.36882 1.22596 1.35708 1.63627 111 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01018 5.28601 5.28601 1.46634 0.26236 1.12701 0.39156 + 81 0.95959 1.42487 1.61756 1.72582 112 a - - > + 1.38629 1.38629 1.38629 1.38629 + 1.04919 0.83246 1.53805 0.70132 0.68504 1.46651 0.26231 + 82 0.70791 1.81901 2.45238 1.35073 118 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01285 5.05362 5.05362 1.46634 0.26236 0.53643 0.87908 + 83 0.37824 2.29597 2.86024 1.85142 119 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01507 5.20637 4.65865 1.46634 0.26236 0.25627 1.48691 + 84 0.48209 1.84439 2.35517 2.04401 120 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01024 5.27925 5.27925 1.46634 0.26236 1.28695 0.32312 + 85 0.69554 1.67316 2.55070 1.44599 121 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01021 5.28296 5.28296 1.46634 0.26236 0.66812 0.71882 + 86 0.69092 2.37661 2.36773 1.16371 122 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01225 5.29224 4.94093 1.46634 0.26236 0.77874 0.61431 + 87 0.29537 3.05064 2.51706 2.05792 123 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01010 5.29363 5.29363 1.46634 0.26236 0.87860 0.53677 + 88 3.19161 2.64038 4.09694 0.13819 124 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 89 0.03012 5.26314 3.99572 5.09995 125 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 90 0.46245 3.22720 1.20648 3.46279 126 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 91 1.48242 1.22824 2.03724 1.05063 127 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 92 3.06787 1.15578 3.76767 0.48522 128 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 93 4.24546 5.86524 0.02387 5.04857 129 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 94 3.46839 0.17739 2.42633 3.14610 130 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 95 0.82279 1.03860 2.66350 1.98675 131 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 96 0.25269 3.63174 1.71202 4.11533 132 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01008 5.29574 5.29574 1.46634 0.26236 1.09861 0.40547 + 97 0.05209 3.52591 4.59586 4.48837 133 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01685 5.29574 4.44812 1.46634 0.26236 1.09861 0.40547 + 98 1.36809 0.72392 2.84902 1.59624 134 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01014 5.28903 5.28903 1.46634 0.26236 1.46651 0.26231 + 99 1.07585 2.28210 0.86925 1.98298 135 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01014 5.28903 5.28903 1.46634 0.26236 1.46651 0.26231 + 100 0.22653 1.95266 3.58185 3.41165 136 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01014 5.28903 5.28903 1.46634 0.26236 1.46651 0.26231 + 101 1.60206 0.77570 2.67825 1.31135 137 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01216 5.28903 4.95605 1.46634 0.26236 1.46651 0.26231 + 102 0.86996 2.51316 0.90435 2.35164 138 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01497 5.28703 4.62471 1.46634 0.26236 1.55376 0.23756 + 103 0.35142 1.99881 2.94696 2.22271 139 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.02447 5.28227 3.95860 1.46634 0.26236 1.73492 0.19409 + 104 1.06548 1.45906 2.07314 1.21338 140 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.05192 5.26816 3.09136 1.46634 0.26236 2.13128 0.12634 + 105 0.74259 1.51640 1.94711 1.82058 141 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01670 5.22704 4.49228 1.46634 0.26236 2.78771 0.06354 + 106 0.51777 1.82415 2.23116 1.99956 142 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03596 5.22120 3.50925 1.46634 0.26236 2.85236 0.05944 + 107 1.65035 0.94051 2.01480 1.25792 143 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.27714 5.19637 1.44175 1.46634 0.26236 3.08505 0.04681 + 108 1.40002 1.88894 2.10135 0.73421 144 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01450 4.93374 4.93374 1.46634 0.26236 1.39986 0.28320 + 109 0.55910 1.68555 2.25670 1.97878 145 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.64634 0.97873 2.30010 2.95319 0.05358 1.03781 0.43731 + 110 1.46440 1.55184 1.80428 0.93565 316 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.24434 5.04670 1.55899 1.46634 0.26236 2.13989 0.12519 + 111 1.64597 1.50706 1.64624 0.93435 317 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01571 4.85456 4.85456 1.46634 0.26236 1.27481 0.32779 + 112 1.16816 1.75094 1.89964 1.00559 318 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.02446 4.99756 4.05052 1.46634 0.26236 2.14146 0.12498 + 113 1.44906 0.90785 1.98507 1.49411 319 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01326 5.02301 5.02301 1.46634 0.26236 0.44496 1.02402 + 114 2.14844 1.45176 0.82318 1.55998 320 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01097 5.21116 5.21116 1.46634 0.26236 1.00291 0.45699 + 115 1.92936 0.81087 1.58545 1.58265 321 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01280 5.24355 4.90145 1.46634 0.26236 1.95617 0.15245 + 116 1.46555 1.31824 1.85159 1.06579 322 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01278 5.24593 4.90219 1.46634 0.26236 1.85172 0.17075 + 117 1.67937 1.39861 1.61357 1.00133 323 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01201 5.24899 5.00732 1.46634 0.26236 1.61032 0.22292 + 118 1.79355 1.55270 1.55171 0.89142 324 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01452 5.25500 4.68944 1.46634 0.26236 2.15297 0.12345 + 119 1.22244 1.38499 1.69433 1.30402 325 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.15467 5.25245 1.97999 1.46634 0.26236 1.84183 0.17260 + 120 1.52574 1.42123 1.22436 1.39766 326 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02678 5.11483 3.89117 1.46634 0.26236 0.29802 1.35592 + 121 1.85480 1.22835 1.13545 1.47202 327 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01609 5.24599 4.53818 1.46634 0.26236 1.31639 0.31211 + 122 1.81186 1.03049 1.65530 1.24208 328 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01052 5.25319 5.25319 1.46634 0.26236 1.71789 0.19777 + 123 1.42867 1.48818 1.22586 1.42260 329 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01046 5.25856 5.25856 1.46634 0.26236 0.95589 0.48527 + 124 1.90115 1.15691 1.18795 1.46405 330 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.83007 0.75061 2.38702 0.90561 0.51801 1.99171 0.14672 + 125 1.92305 1.46557 2.04036 0.70743 369 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.02051 5.18303 4.22040 1.46634 0.26236 0.67217 0.71457 + 126 2.53549 3.15309 2.62662 0.21600 370 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01874 5.23640 4.32421 1.46634 0.26236 1.22568 0.34751 + 127 0.39248 2.28744 2.33154 2.07190 371 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.07265 5.24574 2.73642 1.46634 0.26236 1.66401 0.20995 + 128 0.25563 2.44124 2.60157 2.74320 372 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.22644 5.19224 1.62419 1.46634 0.26236 3.11859 0.04523 + 129 1.45286 2.39020 1.85255 0.65845 373 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.14195 4.97965 2.07578 1.46634 0.26236 1.72796 0.19559 + 130 0.75682 1.63575 2.22838 1.47694 374 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.85160 0.81430 2.03775 1.08588 0.41189 1.55266 0.23786 + 131 1.09269 1.03929 2.16305 1.62960 396 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.03419 4.89197 3.64544 1.46634 0.26236 0.23158 1.57638 + 132 1.56248 1.27530 1.16739 1.61015 397 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01089 5.21866 5.21866 1.46634 0.26236 0.90037 0.52158 + 133 1.62057 1.35292 1.35502 1.25251 398 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01269 5.25186 4.90999 1.46634 0.26236 1.45917 0.26452 + 134 1.36378 1.74963 0.96560 1.66223 399 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.03727 5.25854 3.46145 1.46634 0.26236 1.67313 0.20783 + 135 1.57818 1.26720 1.21947 1.52950 400 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02252 5.23697 4.07760 1.46634 0.26236 0.85527 0.55368 + 136 1.62438 1.40253 1.45420 1.12885 401 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.05825 5.25242 2.96914 1.46634 0.26236 1.91807 0.15887 + 137 1.47619 1.58770 1.27792 1.24312 402 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.07494 5.20895 2.70709 1.46634 0.26236 1.20325 0.35699 + 138 1.15894 1.69829 1.34205 1.41933 403 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.07993 5.17375 2.64293 1.46634 0.26236 1.39518 0.28474 + 139 1.43882 1.67826 1.09414 1.42186 404 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.13297 5.13834 2.13165 1.46634 0.26236 1.83058 0.17474 + 140 1.25881 1.57766 1.27072 1.47438 405 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.18674 5.04568 1.80848 1.46634 0.26236 3.47917 0.03132 + 141 1.53344 1.73627 0.79053 1.86804 406 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.10716 4.87780 2.36444 1.46634 0.26236 1.99927 0.14553 + 142 1.45613 1.06955 1.79778 1.35467 407 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.65051 0.76840 4.23604 2.40201 0.09490 0.37519 1.16205 + 143 1.86207 0.85947 1.62144 1.49767 477 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06705 5.17908 2.82654 1.46634 0.26236 0.30505 1.33594 + 144 1.65248 1.08623 1.39034 1.50530 478 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01085 5.22256 5.22256 1.46634 0.26236 2.83767 0.06035 + 145 1.85126 1.48148 1.56814 0.89838 479 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01320 5.22256 4.86447 1.46634 0.26236 2.83767 0.06035 + 146 2.02258 0.91821 1.91198 1.13736 480 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01087 5.22024 5.22024 1.46634 0.26236 2.86258 0.05882 + 147 1.63662 1.17262 1.62667 1.20656 481 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.04038 5.22024 3.37643 1.46634 0.26236 2.50448 0.08525 + 148 1.60455 1.26725 1.38626 1.31899 482 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.42620 5.19345 1.07452 1.46634 0.26236 0.69960 0.68674 + 149 1.24790 1.73475 1.69521 1.04160 483 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.43986 1.55731 1.92985 0.56265 0.84326 0.51970 0.90312 + 150 1.77143 1.08045 1.87669 1.08657 497 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.04209 5.03800 3.36005 1.46634 0.26236 1.62537 0.21920 + 151 1.53530 1.07770 1.63617 1.38827 498 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03905 5.06461 3.44276 1.46634 0.26236 2.38706 0.09640 + 152 1.65719 1.08597 1.54349 1.35433 499 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03168 5.05825 3.69596 1.46634 0.26236 3.20365 0.04146 + 153 1.64450 1.47094 1.58474 0.98837 500 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.23936 5.04500 1.57782 1.46634 0.26236 0.74481 0.64402 + 154 1.18087 1.46016 1.81253 1.21217 501 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.18282 2.33928 2.64953 0.15770 1.92487 0.17232 1.84332 + 155 1.59963 1.47712 1.10784 1.42936 504 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.06555 5.21053 2.84743 1.46634 0.26236 1.33289 0.30614 + 156 1.61445 1.12169 1.43733 1.43670 505 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02948 5.17985 3.75398 1.46634 0.26236 3.21203 0.04111 + 157 1.42046 1.52907 1.41142 1.21112 506 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01832 5.16189 4.38788 1.46634 0.26236 2.43405 0.09177 + 158 1.80397 1.63871 1.44263 0.90431 507 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.04054 5.16353 3.38130 1.46634 0.26236 3.32161 0.03676 + 159 1.70319 1.19519 1.67175 1.11678 508 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.24243 5.13484 1.56353 1.46634 0.26236 1.65392 0.21233 + 160 1.68524 1.14986 1.66695 1.17410 509 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.50714 1.01472 3.34445 0.56739 0.83703 0.13526 2.06740 + 161 2.02564 1.98225 0.58190 1.76319 515 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01060 5.24538 5.24538 1.46634 0.26236 0.82519 0.57652 + 162 2.51753 0.54522 2.58264 1.33160 516 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01244 5.26938 4.93128 1.46634 0.26236 1.50537 0.25095 + 163 2.21064 0.78730 2.74029 0.99224 517 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01675 5.27151 4.46731 1.46634 0.26236 2.05087 0.13768 + 164 2.04340 0.81082 2.03246 1.22109 518 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.19629 5.26515 1.75412 1.46634 0.26236 1.70609 0.20037 + 165 1.13055 1.99540 1.32229 1.29221 519 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01245 5.08530 5.08530 1.46634 0.26236 0.20016 1.70706 + 166 1.80232 1.51618 1.65231 0.85819 520 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.27427 5.26824 1.44935 1.46634 0.26236 1.80750 0.17920 + 167 1.52531 2.01149 1.34092 0.94920 521 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.94183 1.07576 1.31287 0.41271 1.08428 1.65871 0.21120 + 168 1.51003 1.39537 1.09588 1.62399 527 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.05389 4.78399 3.12117 1.46634 0.26236 0.35147 1.21623 + 169 1.39958 1.64989 1.05123 1.55248 528 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.04481 5.15122 3.26951 1.46634 0.26236 2.77465 0.06440 + 170 1.48483 1.56733 1.27095 1.25775 529 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02062 5.12360 4.23688 1.46634 0.26236 1.82048 0.17668 + 171 1.73606 1.65411 0.94005 1.41917 530 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.11444 5.14229 2.27991 1.46634 0.26236 2.03353 0.14027 + 172 1.38616 1.55401 1.33126 1.29308 531 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.62487 1.49484 1.42552 0.63618 0.75355 0.54580 0.86603 + 173 1.58697 1.16382 1.40025 1.44127 536 c - - - + 1.38629 1.38629 1.38629 1.38629 + 0.20738 4.98183 1.71244 1.46634 0.26236 0.44049 1.03204 + 174 1.52256 1.67918 0.98395 1.50738 537 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01834 5.04968 4.44291 1.46634 0.26236 3.52576 0.02987 + 175 1.50496 1.67686 0.99290 1.51180 538 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02425 5.04669 4.04399 1.46634 0.26236 1.96264 0.15139 + 176 1.51197 1.83245 1.03956 1.32467 539 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.09430 5.07130 2.48027 1.46634 0.26236 2.31845 0.10361 + 177 1.23718 2.05005 0.99810 1.54885 540 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.93698 0.83594 1.74454 2.08543 0.13268 1.55334 0.23767 + 178 0.96051 1.59823 2.14280 1.21160 600 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.24422 4.90576 1.56408 1.46634 0.26236 0.84908 0.55828 + 179 0.89965 1.53805 1.94287 1.44734 601 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.01485 4.91002 4.91002 1.46634 0.26236 0.52494 0.89548 + 180 1.51364 1.47465 1.11157 1.50512 602 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01155 5.16012 5.16012 1.46634 0.26236 0.31611 1.30557 + 181 1.31140 1.75290 1.08765 1.51286 603 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01037 5.26690 5.26690 1.46634 0.26236 1.81372 0.17799 + 182 1.36946 2.03817 0.76997 1.88084 604 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01035 5.26904 5.26904 1.46634 0.26236 2.11095 0.12911 + 183 1.42128 1.67462 1.00217 1.58898 605 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01035 5.26904 5.26904 1.46634 0.26236 2.11095 0.12911 + 184 1.73200 1.43421 1.02931 1.48054 606 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01035 5.26904 5.26904 1.46634 0.26236 2.11095 0.12911 + 185 1.62875 1.60548 0.94157 1.54638 607 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01539 5.26904 4.59281 1.46634 0.26236 2.11095 0.12911 + 186 2.34962 1.56850 2.87053 0.44696 608 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06483 5.26405 2.85430 1.46634 0.26236 2.22165 0.11477 + 187 1.58550 0.61542 2.36725 1.82633 609 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.18007 5.21020 1.83677 1.46634 0.26236 2.96289 0.05305 + 188 0.34293 2.59577 2.21452 2.23948 610 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.08346 5.04312 2.60890 1.46634 0.26236 1.07063 0.41976 + 189 0.88193 2.01158 2.02621 1.13817 611 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.99775 0.94490 1.41645 0.51853 0.90484 0.82746 0.57476 + 190 1.46015 1.08789 2.45147 1.06507 616 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.11549 4.93957 2.28362 1.46634 0.26236 1.34699 0.30113 + 191 1.44774 1.23009 2.19492 1.01814 617 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01421 4.95438 4.95438 1.46634 0.26236 0.52827 0.89069 + 192 1.09485 1.65554 2.27893 0.98879 618 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01366 5.17377 4.84083 1.46634 0.26236 1.11738 0.39621 + 193 0.79606 2.01427 1.98649 1.27904 619 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01095 5.21308 5.21308 1.46634 0.26236 0.50919 0.91875 + 194 0.55847 1.86870 2.38503 1.70647 620 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01036 5.26772 5.26772 1.46634 0.26236 1.21736 0.35099 + 195 1.06469 1.70693 1.17976 1.79342 621 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.18289 5.27552 1.82000 1.46634 0.26236 1.94482 0.15433 + 196 1.32283 1.32216 1.98755 1.10858 622 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01478 5.10484 4.75504 1.46634 0.26236 0.17327 1.83830 + 197 1.36527 2.07791 0.74859 1.92097 623 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01278 5.27338 4.88361 1.46634 0.26236 1.65319 0.21250 + 198 1.14099 3.10095 0.61889 2.33358 624 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01031 5.27308 5.27308 1.46634 0.26236 2.01076 0.14374 + 199 1.64189 2.73873 0.41745 2.48877 625 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.04884 5.27308 3.15730 1.46634 0.26236 2.01076 0.14374 + 200 0.94066 1.24791 2.18681 1.55946 626 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.18459 5.23495 1.81259 1.46634 0.26236 2.69226 0.07013 + 201 1.79632 2.35502 2.32239 0.44448 627 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.19611 5.06309 1.76172 1.46634 0.26236 2.51748 0.08410 + 202 0.96267 1.16545 1.92426 1.83033 628 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.80062 1.08235 1.55047 0.60469 0.79019 1.86160 0.16892 + 203 1.43970 1.81699 0.73028 2.13104 663 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.24495 4.75823 1.56699 1.46634 0.26236 0.96654 0.47867 + 204 1.65583 1.25811 1.47805 1.21471 664 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01614 4.82762 4.82762 1.46634 0.26236 1.26984 0.32972 + 205 1.83709 1.13674 1.84116 1.01826 665 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01619 4.98156 4.68875 1.46634 0.26236 0.71841 0.66851 + 206 1.57695 1.61082 1.15887 1.27358 666 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01169 5.14776 5.14776 1.46634 0.26236 0.23489 1.56378 + 207 1.60422 1.27944 1.40252 1.29177 667 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01218 5.27358 4.96434 1.46634 0.26236 1.99774 0.14577 + 208 1.57587 1.40570 1.27168 1.31820 668 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02389 5.27172 3.99165 1.46634 0.26236 2.04572 0.13844 + 209 1.59270 1.36525 1.46817 1.16810 669 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01327 5.25829 4.83088 1.46634 0.26236 0.95915 0.48324 + 210 1.41087 1.59774 1.27002 1.29869 670 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03138 5.27084 3.65922 1.46634 0.26236 1.64016 0.21561 + 211 1.50019 1.48182 1.18689 1.40846 671 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.34635 5.25281 1.24652 1.46634 0.26236 2.43214 0.09195 + 212 1.56131 1.42783 1.54748 1.08611 672 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.05932 4.92114 2.98974 1.46634 0.26236 1.72796 0.19559 + 213 1.51169 1.45175 1.37765 1.22714 673 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 1.01985 1.09039 1.19315 0.04143 3.20434 0.63613 0.75361 + 214 0.92307 1.66323 1.74710 1.43173 675 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.23810 4.87466 1.58849 1.46634 0.26236 1.85446 0.17024 + 215 1.16137 1.64705 1.67467 1.18105 676 a - - _ + 1.38629 1.38629 1.38629 1.38629 + 1.14197 0.56356 2.19258 0.03018 3.51569 1.03763 0.43741 + 216 1.94791 0.87634 2.09529 1.14542 678 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.77374 0.72341 2.92578 0.29251 1.37194 0.57744 0.82401 + 217 1.74027 0.91372 1.95310 1.26704 683 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.08698 5.10603 2.56079 1.46634 0.26236 1.07023 0.41997 + 218 1.65062 1.87302 1.03523 1.20643 684 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01219 5.10666 5.10666 1.46634 0.26236 0.67743 0.70912 + 219 2.18954 1.66223 0.84910 1.30741 685 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01098 5.21002 5.21002 1.46634 0.26236 0.49138 0.94619 + 220 2.40530 0.91704 1.81182 1.05928 686 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01249 5.26764 4.92634 1.46634 0.26236 1.85792 0.16960 + 221 2.39669 0.92809 2.22355 0.90276 687 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01296 5.26725 4.86380 1.46634 0.26236 1.81085 0.17855 + 222 1.60741 1.62192 1.24806 1.15514 688 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01037 5.26678 5.26678 1.46634 0.26236 2.16258 0.12220 + 223 1.55862 1.40204 1.19735 1.42094 689 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.50137 5.26678 0.94382 1.46634 0.26236 1.84051 0.17285 + 224 1.65136 1.81139 0.81051 1.60867 690 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 1.11380 0.41047 4.78549 0.86024 0.55002 0.47080 0.97950 + 225 1.39763 1.91366 1.14614 1.24682 712 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.74224 0.76260 2.85597 0.64773 0.74073 1.84115 0.17273 + 226 1.45454 1.72328 1.03534 1.45713 716 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.14265 5.11023 2.06427 1.46634 0.26236 0.30336 1.34069 + 227 1.47149 1.73012 1.00280 1.48588 717 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01873 5.14652 4.36358 1.46634 0.26236 0.48572 0.95518 + 228 1.21064 1.58109 1.39225 1.39543 718 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01067 5.23912 5.23912 1.46634 0.26236 0.89784 0.52332 + 229 1.18806 1.83087 1.39109 1.25138 719 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01041 5.26373 5.26373 1.46634 0.26236 1.92464 0.15774 + 230 1.52824 1.56784 1.04651 1.49867 720 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01227 5.26556 4.95729 1.46634 0.26236 1.79963 0.18076 + 231 1.59100 1.38189 1.14173 1.48763 721 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01574 5.26616 4.56050 1.46634 0.26236 1.86810 0.16773 + 232 1.42291 1.80130 1.09626 1.34790 722 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.08661 5.26272 2.55384 1.46634 0.26236 1.84081 0.17279 + 233 1.47485 1.49721 1.29516 1.29616 723 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02226 5.19016 4.10794 1.46634 0.26236 2.84210 0.06007 + 234 1.30046 2.06910 1.15515 1.25077 724 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.07393 5.18115 2.72355 1.46634 0.26236 3.20266 0.04150 + 235 0.97826 1.84479 1.34360 1.58439 725 a - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02247 5.11925 4.12052 1.46634 0.26236 2.99322 0.05143 + 236 0.62732 2.50885 1.58360 1.71825 726 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.02363 5.11357 4.05498 1.46634 0.26236 3.58965 0.02800 + 237 0.23559 3.42510 2.46066 2.38629 727 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.06319 4.75088 2.94525 1.08485 0.41242 3.64031 0.02659 + 238 0.90754 1.86423 1.44594 1.58016 729 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.09215 5.05457 2.50535 1.46634 0.26236 2.07561 0.13408 + 239 0.79066 1.66698 1.85609 1.60267 730 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.46770 5.00850 1.00273 1.46634 0.26236 0.55783 0.84968 + 240 1.08254 1.93813 1.26416 1.44896 731 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.71894 0.68373 4.82827 0.48571 0.95518 1.03861 0.43687 + 241 1.14035 1.37857 2.55474 1.04799 735 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.25657 5.02007 1.51553 1.46634 0.26236 0.31769 1.30132 + 242 1.43450 1.57917 2.05296 0.85035 736 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01552 5.04549 4.71424 1.46634 0.26236 0.29631 1.36085 + 243 0.81283 2.13830 2.35923 1.06697 737 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01785 5.24173 4.39004 1.46634 0.26236 1.38426 0.28836 + 244 0.72571 1.83180 2.28267 1.37090 738 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01058 5.24719 5.24719 1.46634 0.26236 1.00116 0.45800 + 245 1.13689 1.74299 1.67682 1.14816 739 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01038 5.26584 5.26584 1.46634 0.26236 1.83025 0.17480 + 246 1.25786 1.44384 1.34298 1.52027 740 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01036 5.26802 5.26802 1.46634 0.26236 2.13455 0.12590 + 247 1.21240 1.29206 1.54349 1.54094 741 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01036 5.26802 5.26802 1.46634 0.26236 2.13455 0.12590 + 248 0.93414 2.29314 0.89661 2.32100 742 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01285 5.26802 4.87825 1.46634 0.26236 2.13455 0.12590 + 249 1.11478 2.06631 0.86888 2.07196 743 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01575 5.26556 4.56029 1.46634 0.26236 1.79963 0.18076 + 250 1.37279 1.12254 1.62724 1.49309 744 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.03283 5.26273 3.60756 1.46634 0.26236 2.24893 0.11150 + 251 1.71945 1.24141 2.48185 0.80236 745 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.16378 5.24055 1.92572 1.46634 0.26236 1.30804 0.31519 + 252 1.24627 1.75416 1.41179 1.21852 746 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.44688 1.31241 2.39462 0.15535 1.93875 0.63777 0.75178 + 253 1.82907 1.87131 0.69825 1.67100 750 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.05860 5.13430 2.97546 1.46634 0.26236 1.10219 0.40368 + 254 1.85077 1.10512 1.60943 1.16568 751 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.05955 5.14726 2.95659 1.46634 0.26236 1.18633 0.36433 + 255 1.56276 1.19837 1.73076 1.16601 752 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01167 5.14946 5.14946 1.46634 0.26236 0.70045 0.68590 + 256 1.48435 1.52487 1.61348 1.03140 753 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02373 5.22737 4.01256 1.46634 0.26236 2.78394 0.06379 + 257 1.50688 1.42475 1.41811 1.21855 754 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.13336 5.21457 2.12516 1.46634 0.26236 1.55838 0.23633 + 258 1.37351 1.56206 1.40249 1.23410 755 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02558 5.11122 3.95157 1.46634 0.26236 0.51096 0.91610 + 259 1.51028 1.54072 1.54310 1.04638 756 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.12257 5.21845 2.20778 1.46634 0.26236 2.88124 0.05770 + 260 1.64843 1.49051 1.38490 1.10249 757 u - - < + 1.38629 1.38629 1.38629 1.38629 + 0.03273 5.10805 3.64385 1.46634 0.26236 1.70568 0.20046 + 261 1.24913 1.67992 1.34161 1.32640 758 a - - < + 1.38629 1.38629 1.38629 1.38629 + 0.10654 5.12259 2.35283 1.46634 0.26236 0.67059 0.71622 + 262 1.54958 1.57321 1.35592 1.13142 759 u - - < + 1.38629 1.38629 1.38629 1.38629 + 1.12142 1.04881 1.12753 0.84002 0.56511 1.18655 0.36423 + 263 1.14992 1.86894 1.68185 1.06996 763 u - - - + 1.38629 1.38629 1.38629 1.38629 + 0.03670 4.82595 3.57494 1.46634 0.26236 0.49830 0.93537 + 264 1.05096 1.64235 1.37576 1.58853 764 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.02361 5.12674 4.05161 1.46634 0.26236 0.56314 0.84261 + 265 1.83822 1.60555 0.93686 1.39325 765 g - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01607 5.21985 4.55355 1.46634 0.26236 2.86664 0.05857 + 266 1.77285 0.89989 1.48722 1.62182 766 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.04974 5.21472 3.14462 1.46634 0.26236 2.91912 0.05549 + 267 2.04943 1.08627 1.37402 1.27071 767 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.57104 1.21801 1.97154 0.37567 1.16101 1.92794 0.15718 + 268 2.13670 2.46081 2.06377 0.40105 771 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01290 5.05040 5.05040 1.46634 0.26236 0.39951 1.11062 + 269 2.39962 3.02646 0.29025 2.18318 772 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01080 5.22684 5.22684 1.46634 0.26236 1.92130 0.15831 + 270 1.93134 1.75513 1.58558 0.73954 773 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01072 5.23424 5.23424 1.46634 0.26236 2.70122 0.06948 + 271 2.28774 0.71997 2.70590 1.06443 774 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01389 5.23424 4.77186 1.46634 0.26236 2.70122 0.06948 + 272 1.61730 1.15283 1.74193 1.16911 775 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.65544 0.74352 5.23110 0.63727 0.75233 2.05918 0.13646 + 273 1.69685 1.89225 0.85172 1.42992 778 g - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.11285 5.23631 2.28871 1.46634 0.26236 2.49504 0.08609 + 274 2.01456 2.04841 1.78857 0.56127 779 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.14418 5.13645 2.05271 1.46634 0.26236 3.47734 0.03138 + 275 1.90395 0.96343 1.35025 1.55940 780 c - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.08353 3.15161 3.28728 0.52957 0.88882 0.37980 1.15200 + 276 1.52841 1.43177 0.93894 1.87606 784 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02688 5.01511 3.91769 1.25702 0.33478 2.12554 0.12712 + 277 1.83039 1.78590 0.79106 1.52032 786 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01122 5.18842 5.18842 1.46634 0.26236 2.05483 0.13710 + 278 1.68480 0.98843 1.35331 1.69297 787 c - - > + 1.38629 1.38629 1.38629 1.38629 + 0.31394 5.19943 1.33212 1.46634 0.26236 1.37822 0.29039 + 279 1.01476 1.88801 1.33913 1.49583 788 a - - - + 1.38629 1.38629 1.38629 1.38629 + 0.66477 1.00327 2.12922 0.88002 0.53576 0.65467 0.73316 + 280 1.31757 1.93467 1.01700 1.48693 792 g - - - + 1.38629 1.38629 1.38629 1.38629 + 0.14270 5.04573 2.06713 1.46634 0.26236 0.58265 0.81739 + 281 1.39088 1.56125 1.25754 1.35900 793 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01368 5.08768 4.90408 1.46634 0.26236 1.89669 0.16259 + 282 1.54769 1.53317 1.41489 1.11334 794 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01482 5.11731 4.74196 1.46634 0.26236 2.58661 0.07826 + 283 1.48184 1.53461 1.11031 1.47935 795 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01541 5.12462 4.67269 1.46634 0.26236 2.25831 0.11040 + 284 1.44211 1.62866 1.21105 1.31120 796 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.17747 5.13657 1.85317 1.46634 0.26236 3.47671 0.03140 + 285 1.46656 1.66854 1.16886 1.30919 797 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01922 4.97304 4.41310 1.46634 0.26236 0.31325 1.31329 + 286 1.44834 1.56189 1.17957 1.39477 798 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01086 5.22106 5.22106 1.46634 0.26236 2.29387 0.10633 + 287 1.25346 1.64816 1.21653 1.48800 799 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01447 5.22511 4.71184 1.46634 0.26236 2.80961 0.06212 + 288 1.33245 1.93780 1.02571 1.45412 800 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01086 5.22149 5.22149 1.46634 0.26236 2.33594 0.10172 + 289 1.50050 1.75746 0.83818 1.76024 801 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01082 5.22511 5.22511 1.46634 0.26236 2.80961 0.06212 + 290 1.69844 1.15657 1.72530 1.12593 802 u - - > + 1.38629 1.38629 1.38629 1.38629 + 0.02196 5.22511 4.11389 1.46634 0.26236 2.80961 0.06212 + 291 1.60877 2.57520 0.80018 1.29287 803 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01320 5.21408 4.87021 1.46634 0.26236 2.92539 0.05514 + 292 0.21649 2.86307 2.45663 2.95959 804 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01651 5.21185 4.51727 1.46634 0.26236 2.94716 0.05392 + 293 0.45953 2.27439 1.77509 2.34248 805 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.05574 5.20637 3.02130 1.46634 0.26236 2.99846 0.05115 + 294 0.78079 1.95455 2.13315 1.26633 806 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.45140 5.16215 1.02852 1.46634 0.26236 0.49675 0.93778 + 295 0.91597 1.91612 2.26647 1.05263 807 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.88094 0.54842 4.86090 2.14358 0.12470 0.26104 1.47075 + 296 1.53017 1.16948 1.67835 1.25074 858 c - - , + 1.38629 1.38629 1.38629 1.38629 + 1.42726 0.83291 1.12315 0.02473 3.71205 2.28452 0.10739 + 297 0.37781 2.36909 2.40714 2.03254 860 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01595 4.83944 4.83944 1.46634 0.26236 1.37007 0.29315 + 298 0.44077 2.75365 2.83231 1.45291 861 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01392 4.97488 4.97488 1.46634 0.26236 0.80608 0.59168 + 299 0.47758 2.17075 2.50647 1.69246 862 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01187 5.13300 5.13300 1.46634 0.26236 0.60744 0.78690 + 300 1.51166 1.77931 1.01923 1.38697 863 g - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01078 5.22832 5.22832 1.46634 0.26236 2.22888 0.11390 + 301 0.62137 1.80168 1.97001 1.84318 864 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01074 5.23219 5.23219 1.46634 0.26236 2.72671 0.06767 + 302 1.14939 1.11839 1.85872 1.60697 865 c - - , + 1.38629 1.38629 1.38629 1.38629 + 0.31793 5.23219 1.32050 1.46634 0.26236 2.26643 0.10946 + 303 0.97274 1.86445 1.46686 1.44255 866 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.33964 4.93306 1.27022 1.46634 0.26236 1.64604 0.21420 + 304 1.49100 1.42916 1.58432 1.10789 867 u - - , + 1.38629 1.38629 1.38629 1.38629 + 0.02787 4.71948 3.98627 1.46634 0.26236 0.17202 1.84493 + 305 1.21686 1.62179 1.35672 1.39113 868 a - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01216 5.22640 5.00337 1.46634 0.26236 2.06189 0.13606 + 306 1.15381 2.82115 0.63310 2.36354 869 G - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01076 5.23085 5.23085 1.46634 0.26236 2.51990 0.08389 + 307 0.61971 1.71578 1.86815 2.05833 870 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.14901 5.23219 2.01666 1.46634 0.26236 1.68417 0.20530 + 308 2.60857 0.17906 3.82641 2.68069 871 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.09115 2.51248 5.10669 0.54513 0.86695 0.08280 2.53244 + 309 3.37796 3.59274 3.66707 0.09123 875 U - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 310 0.15972 4.02650 2.17643 4.11452 876 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01384 4.74316 5.29087 1.28144 0.32523 1.37852 0.29029 + 311 0.57785 1.35667 3.40558 1.90923 880 A - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 312 1.33409 2.97893 0.47012 2.79968 881 G - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 313 2.64552 0.33281 2.53726 2.01710 882 C - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 314 0.70965 1.89639 1.78912 1.65566 883 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 315 3.40561 1.08400 3.02911 0.54436 884 U - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01013 5.29087 5.29087 1.46634 0.26236 1.37852 0.29029 + 316 3.78241 4.95961 0.06175 3.50322 885 G - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01328 5.29087 4.80944 1.46634 0.26236 1.37852 0.29029 + 317 3.26592 3.60817 2.13295 0.20303 886 U - - - + 1.38629 1.38629 1.38629 1.38629 + 0.07794 5.28775 2.66033 1.46634 0.26236 1.04189 0.43508 + 318 0.06909 4.32219 3.82937 3.44953 887 A - - - + 1.38629 1.38629 1.38629 1.38629 + 0.51805 1.18376 2.32085 0.05882 2.86246 0.40790 1.09376 + 319 1.98618 2.69576 0.61854 1.36039 891 G - - - + 1.38629 1.38629 1.38629 1.38629 + 0.02346 5.18215 4.04147 1.46634 0.26236 0.26988 1.44167 + 320 0.76226 2.16324 1.35111 1.83579 892 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01291 5.26325 4.87348 1.46634 0.26236 0.56755 0.83681 + 321 1.15971 1.30456 1.54566 1.59969 893 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01023 5.28115 5.28115 1.46634 0.26236 1.27224 0.32879 + 322 1.39974 1.33765 1.27077 1.55940 894 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01020 5.28358 5.28358 1.46634 0.26236 1.56720 0.23399 + 323 1.74303 1.62543 1.03964 1.29244 895 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.31756 5.28358 1.32050 1.46634 0.26236 0.96606 0.47897 + 324 1.48328 1.43702 1.50126 1.16276 896 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.06767 4.98551 2.83717 1.46634 0.26236 3.67666 0.02563 + 325 1.64397 1.49017 1.34609 1.13570 897 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.11669 4.93530 2.27347 1.46634 0.26236 0.31268 1.31485 + 326 1.08026 1.70637 1.50338 1.36027 898 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.08513 5.13987 2.58028 1.46634 0.26236 0.62518 0.76607 + 327 1.47433 1.72469 1.22505 1.20699 899 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01153 5.16161 5.16161 1.46634 0.26236 0.15468 1.94274 + 328 1.54149 1.94795 0.82581 1.58236 900 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01668 5.28288 4.46826 1.46634 0.26236 0.92200 0.50704 + 329 1.37375 1.94224 1.16021 1.23773 901 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01022 5.28137 5.28137 1.46634 0.26236 0.83928 0.56567 + 330 1.58965 1.89026 1.08863 1.17670 902 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01370 5.28775 4.76110 1.46634 0.26236 1.37852 0.29029 + 331 1.64767 1.81548 0.97365 1.32036 903 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.15142 5.28424 1.99918 1.46634 0.26236 1.01285 0.45127 + 332 1.42620 1.83674 1.13120 1.28085 904 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.86499 1.56485 0.99472 0.90866 0.51594 0.06976 2.69731 + 333 1.50248 1.44408 1.28783 1.32580 911 g - - - + 1.38629 1.38629 1.38629 1.38629 + 0.21203 4.91403 1.69436 1.46634 0.26236 0.03092 3.49164 + 334 0.82768 1.91152 1.49602 1.65514 912 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01150 5.16391 5.16391 1.46634 0.26236 1.31177 0.31381 + 335 1.39150 1.83330 0.96915 1.55113 913 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01591 5.19918 4.57941 1.46634 0.26236 0.19601 1.72601 + 336 1.81421 1.61284 1.07865 1.21180 914 g - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01024 5.27973 5.27973 1.46634 0.26236 0.76553 0.62565 + 337 1.08720 1.83335 1.24516 1.53679 915 a - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.04245 5.28775 3.31028 1.46634 0.26236 1.37852 0.29029 + 338 1.40497 1.37661 1.68343 1.15057 916 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01049 5.25579 5.25579 1.46634 0.26236 0.34428 1.23351 + 339 2.05268 1.38584 1.75697 0.80089 917 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01033 5.27054 5.27054 1.46634 0.26236 1.37852 0.29029 + 340 2.36052 1.67127 1.58602 0.66771 918 U - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01036 5.26794 5.26794 1.46634 0.26236 1.37852 0.29029 + 341 1.72429 1.66155 1.48277 0.90424 919 u - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01041 5.26291 5.26291 1.46634 0.26236 1.37852 0.29029 + 342 2.18426 0.74258 2.83374 1.04197 920 c - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01815 5.23458 4.36929 1.46634 0.26236 1.37852 0.29029 + 343 4.31585 5.26103 0.02618 4.92053 921 G - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01633 5.22722 4.52562 1.46634 0.26236 1.49119 0.25503 + 344 3.79395 3.91534 0.07940 3.38475 922 G - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.01095 5.21303 5.21303 1.46634 0.26236 0.80367 0.59363 + 345 0.10957 3.71038 3.25690 3.19887 923 A - - ) + 1.38629 1.38629 1.38629 1.38629 + 0.03670 4.37584 3.75244 0.71785 0.66904 1.48194 0.25773 + 346 3.56096 0.06154 4.29333 4.03922 925 C - - , + 1.38629 1.38629 1.38629 1.38629 + 0.01118 5.19264 5.19264 1.46634 0.26236 2.04128 0.13910 + 347 1.80814 2.41718 0.38482 2.71363 926 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01118 5.19264 5.19264 1.46634 0.26236 2.04128 0.13910 + 348 2.29764 0.95381 1.17307 1.58562 927 c - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01626 5.19015 4.55104 1.46634 0.26236 2.04128 0.13910 + 349 3.65627 2.94752 0.09494 4.40011 928 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.05427 5.18515 3.05278 1.46634 0.26236 2.15121 0.12369 + 350 2.33364 4.70714 0.12408 4.53551 929 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.02806 5.14263 3.82471 1.46634 0.26236 2.77447 0.06441 + 351 4.01988 5.04894 0.03166 4.99240 930 G - - < + 1.38629 1.38629 1.38629 1.38629 + 0.01195 5.12652 5.12652 1.46634 0.26236 2.93203 0.05476 + 352 4.94714 4.63380 5.52194 0.02104 931 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01195 5.12652 5.12652 1.46634 0.26236 2.93203 0.05476 + 353 4.94714 4.63380 5.52194 0.02104 932 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01195 5.12652 5.12652 1.46634 0.26236 2.93203 0.05476 + 354 5.16638 0.02062 5.49893 4.54568 933 C - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01472 5.12652 4.74679 1.46634 0.26236 2.93203 0.05476 + 355 0.84422 4.32972 0.61570 4.09369 934 G - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 356 0.01466 5.56699 5.15324 5.30895 935 A - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 357 1.62870 1.18188 2.46624 0.88622 936 u - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 358 3.43924 3.07022 4.21086 0.09798 937 U - - _ + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 359 5.13520 0.03570 5.05615 3.78023 938 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 360 4.84649 0.12803 4.73156 2.26811 939 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01198 5.12377 5.12377 1.46634 0.26236 2.95635 0.05341 + 361 4.74564 0.10279 2.91691 3.35558 940 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01649 5.12377 4.56589 1.46634 0.26236 2.95635 0.05341 + 362 1.78981 1.19563 0.87071 2.19066 941 g - - > + 1.38629 1.38629 1.38629 1.38629 + 0.01203 5.11932 5.11932 1.46634 0.26236 1.36672 0.29429 + 363 2.96182 0.43844 2.18967 1.65403 942 C - - > + 1.38629 1.38629 1.38629 1.38629 + 0.04707 4.58500 3.33045 0.90972 0.51523 2.76520 0.06503 + 364 4.50550 0.04332 4.95910 3.71595 944 C - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01211 5.11310 5.11310 1.46634 0.26236 2.33372 0.10196 + 365 0.76886 3.58654 0.75506 3.24970 945 g - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01203 5.11932 5.11932 1.46634 0.26236 2.99446 0.05136 + 366 2.36338 1.04539 1.12150 1.47599 946 c - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01203 5.11932 5.11932 1.46634 0.26236 2.99446 0.05136 + 367 3.97423 0.07392 4.26295 3.26012 947 C - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01518 5.11795 4.70189 1.46634 0.26236 2.99446 0.05136 + 368 4.54609 3.53173 4.49905 0.05233 948 U - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11486 5.11486 1.46634 0.26236 3.01997 0.05003 + 369 4.92647 0.04027 4.94433 3.68527 949 C - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11486 5.11486 1.46634 0.26236 3.01997 0.05003 + 370 4.83910 0.04208 4.88961 3.65845 950 C - - ] + 1.38629 1.38629 1.38629 1.38629 + 0.01209 5.11486 5.11486 1.46634 0.26236 3.01997 0.05003 + 371 0.01483 5.55455 5.14151 5.29791 951 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.01734 5.06991 4.51834 1.46634 0.26236 3.01997 0.05003 + 372 2.95621 0.34768 3.61705 1.53806 952 C - - : + 1.38629 1.38629 1.38629 1.38629 + 0.01281 5.05730 5.05730 1.46634 0.26236 3.05525 0.04826 + 373 1.95693 0.51917 2.98081 1.54674 953 C - - : + 1.38629 1.38629 1.38629 1.38629 + 0.01281 5.05730 5.05730 1.46634 0.26236 0.09896 2.36211 + 374 0.51475 2.34762 1.98749 1.77363 954 A - - : + 1.38629 1.38629 1.38629 1.38629 + 0.00575 5.16131 * 1.46634 0.26236 0.00000 * +// diff --git a/tests/test_data/rfam/Rfam_metadata.tsv b/tests/test_data/rfam/Rfam_metadata.tsv new file mode 100644 index 0000000..6be18a2 --- /dev/null +++ b/tests/test_data/rfam/Rfam_metadata.tsv @@ -0,0 +1,6 @@ +rfam_acc rfam_id type description ga_threshold clan_acc +RF00005 tRNA Gene; tRNA; tRNA 29.00 CL00001 +RF00023 tmRNA Gene; transfer-messenger RNA 47.00 CL00001 +RF01492 rli28 Gene; sRNA; Listeria sRNA rli28 45.00 +RF01828 SprD Gene; sRNA; Small pathogenicity island RNA D 100.00 +RF02672 SprX Gene; sRNA; Small pathogenicity island RNA X 80.00 diff --git a/tests/test_rfam.py b/tests/test_rfam.py new file mode 100644 index 0000000..49919aa --- /dev/null +++ b/tests/test_rfam.py @@ -0,0 +1,369 @@ +"""Tests for Rfam / Infernal ncRNA annotation.""" + +import os +import shutil +import subprocess + +import polars as pl +import pytest + +from pharokka.post_processing import Pharok +from pharokka.rfam import ( + TRNA_TMRNA_ACCESSIONS, + add_locus_tags, + load_rfam_metadata, + parse_cmscan_tblout, + rfam_type_to_ncrna_class, + write_ncrna_tsv, +) + +TEST_DATA = os.path.join(os.path.dirname(__file__), "test_data") +RFAM_DIR = os.path.join(TEST_DATA, "rfam") +NC_004617 = os.path.join(TEST_DATA, "overall", "VFDB_example", "NC_004617.fasta") +NC_051700 = os.path.join(TEST_DATA, "overall", "tmRNA_example", "NC_051700.fasta") + +# A real cmscan --fmt 2 header, kept verbatim so the fixtures below stay +# aligned with the column layout the parser assumes. +TBLOUT_HEADER = """\ +#idx target name accession query name accession clan name mdl mdl from mdl to seq from seq to strand trunc pass gc bias score E-value inc olp anyidx afrct1 afrct2 winidx wfrct1 wfrct2 mdl len seq len description of target +#--- -------------------- --------- -------------------- --------- --------- --- -------- -------- -------- -------- ------ ----- ---- ---- ----- ------ --------- --- --- ------ ------ ------ ------ ------ ------ ------- ------- --------------------- +""" + + +def _row( + idx=1, + name="SprX", + acc="RF02672", + query="NC_004617.1", + clan="-", + seq_from=39255, + seq_to=39405, + strand="+", + score=195.7, + evalue="1.2e-44", + inc="!", + olp="*", + desc="Small pathogenicity island RNA X", +): + return ( + f"{idx} {name} {acc} {query} - {clan} cm 1 151 " + f"{seq_from} {seq_to} {strand} no 1 0.37 0.1 {score} " + f"{evalue} {inc} {olp} - - - - - - 151 " + f"42722 {desc}\n" + ) + + +def _write_tblout(tmp_path, rows): + path = tmp_path / "test_cmscan.tblout" + path.write_text(TBLOUT_HEADER + "".join(rows) + "#\n") + return str(path) + + +class TestParseCmscanTblout: + def test_parses_a_basic_hit(self, tmp_path): + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row()])) + + assert df.height == 1 + row = df.row(0, named=True) + assert row["contig"] == "NC_004617.1" + assert row["rfam_acc"] == "RF02672" + assert row["rfam_id"] == "SprX" + assert row["start"] == 39255 + assert row["stop"] == 39405 + assert row["strand"] == "+" + assert row["bitscore"] == pytest.approx(195.7) + assert row["evalue"] == pytest.approx(1.2e-44) + + def test_description_is_read_from_the_final_field(self, tmp_path): + """Guards the field count: mdl len and seq len precede the description.""" + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row()])) + assert df.row(0, named=True)["description"] == ( + "Small pathogenicity island RNA X" + ) + + def test_below_gathering_threshold_hits_are_dropped(self, tmp_path): + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row(inc="?")])) + assert df.height == 0 + + def test_clan_competition_losers_are_dropped(self, tmp_path): + """olp '=' marks a hit overlapping a better one in the same clan.""" + rows = [_row(idx=1, olp="^"), _row(idx=2, acc="RF00050", olp="=")] + df = parse_cmscan_tblout(_write_tblout(tmp_path, rows)) + + assert df.height == 1 + assert df.row(0, named=True)["rfam_acc"] == "RF02672" + + def test_minus_strand_coordinates_are_normalised(self, tmp_path): + """cmscan reports seq from > seq to on the minus strand.""" + rows = [_row(seq_from=138562, seq_to=138490, strand="-")] + df = parse_cmscan_tblout(_write_tblout(tmp_path, rows)) + + row = df.row(0, named=True) + assert row["start"] == 138490 + assert row["stop"] == 138562 + assert row["strand"] == "-" + + @pytest.mark.parametrize("accession", sorted(TRNA_TMRNA_ACCESSIONS)) + def test_trna_and_tmrna_dropped_by_default(self, tmp_path, accession): + """tRNAscan-SE and ARAGORN already annotate these.""" + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row(acc=accession)])) + assert df.height == 0 + + @pytest.mark.parametrize("accession", sorted(TRNA_TMRNA_ACCESSIONS)) + def test_trna_and_tmrna_kept_with_flag(self, tmp_path, accession): + df = parse_cmscan_tblout( + _write_tblout(tmp_path, [_row(acc=accession)]), keep_trna=True + ) + assert df.height == 1 + + def test_hits_are_sorted_by_position(self, tmp_path): + rows = [ + _row(idx=1, seq_from=40870, seq_to=41011, acc="RF01828"), + _row(idx=2, seq_from=36836, seq_to=37015, acc="RF01492"), + ] + df = parse_cmscan_tblout(_write_tblout(tmp_path, rows)) + assert df["start"].to_list() == [36836, 40870] + + def test_missing_file_returns_empty_frame(self, tmp_path): + df = parse_cmscan_tblout(str(tmp_path / "nope.tblout")) + assert df.height == 0 + assert "rfam_acc" in df.columns + + def test_empty_result_keeps_schema(self, tmp_path): + df = parse_cmscan_tblout(_write_tblout(tmp_path, [])) + assert df.height == 0 + assert ( + df.columns == parse_cmscan_tblout(_write_tblout(tmp_path, [_row()])).columns + ) + + def test_metadata_overrides_target_name(self, tmp_path): + metadata = { + "RF02672": { + "rfam_id": "SprX", + "type": "Gene; sRNA;", + "description": "Small pathogenicity island RNA X", + "clan_acc": "", + } + } + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row()]), metadata=metadata) + assert df.row(0, named=True)["type"] == "Gene; sRNA;" + + +class TestNcrnaClass: + @pytest.mark.parametrize( + "rfam_type,expected", + [ + ("Gene; sRNA;", "ncRNA"), + ("Gene; ribozyme;", "ribozyme"), + ("Gene; antisense;", "antisense_RNA"), + ("Gene; snRNA; snoRNA; CD-box;", "snoRNA"), + ("Gene; snRNA; splicing;", "snRNA"), + ("Gene; miRNA;", "miRNA"), + ("Intron;", "autocatalytically_spliced_intron"), + # riboswitches have no INSDC ncRNA_class + ("Cis-reg; riboswitch;", "other"), + ("Cis-reg; thermoregulator;", "other"), + ("", "other"), + (None, "other"), + ], + ) + def test_mapping(self, rfam_type, expected): + assert rfam_type_to_ncrna_class(rfam_type) == expected + + +class TestLocusTags: + def test_single_contig_uses_locustag_prefix(self, tmp_path): + rows = [ + _row(idx=1, seq_from=100, seq_to=200), + _row(idx=2, seq_from=300, seq_to=400), + ] + df = add_locus_tags( + parse_cmscan_tblout(_write_tblout(tmp_path, rows)), "ABCDE", 1 + ) + assert df["locus_tag"].to_list() == ["ABCDE_ncRNA_1", "ABCDE_ncRNA_2"] + + def test_multi_contig_numbers_per_contig(self, tmp_path): + rows = [ + _row(idx=1, query="contig1", seq_from=100, seq_to=200), + _row(idx=2, query="contig1", seq_from=300, seq_to=400), + _row(idx=3, query="contig2", seq_from=100, seq_to=200), + ] + df = add_locus_tags( + parse_cmscan_tblout(_write_tblout(tmp_path, rows)), "ABCDE", 2 + ) + assert df["locus_tag"].to_list() == [ + "contig1_ncRNA_1", + "contig1_ncRNA_2", + "contig2_ncRNA_1", + ] + + def test_empty_frame_is_left_alone(self, tmp_path): + df = add_locus_tags( + parse_cmscan_tblout(_write_tblout(tmp_path, [])), "ABCDE", 1 + ) + assert df.height == 0 + + +class TestMetadataAndOutput: + def test_load_metadata(self): + metadata = load_rfam_metadata(RFAM_DIR) + assert metadata["RF00023"]["rfam_id"] == "tmRNA" + assert metadata["RF01828"]["type"] == "Gene; sRNA;" + + def test_write_ncrna_tsv(self, tmp_path): + df = add_locus_tags( + parse_cmscan_tblout(_write_tblout(tmp_path, [_row()])), "ABCDE", 1 + ) + write_ncrna_tsv(df, str(tmp_path), "test") + + out = tmp_path / "test_ncrna.tsv" + lines = out.read_text().strip().split("\n") + assert lines[0].split("\t")[:3] == ["contig", "locus_tag", "start"] + assert len(lines) == 2 + + def test_write_ncrna_tsv_when_empty(self, tmp_path): + """A header-only file is still written, so the output set is stable.""" + write_ncrna_tsv( + parse_cmscan_tblout(str(tmp_path / "no.tblout")), str(tmp_path), "t" + ) + assert ( + (tmp_path / "t_ncrna.tsv") + .read_text() + .strip() + .split("\n")[0] + .startswith("contig") + ) + + +class TestGffConstruction: + """Pharok._build_ncrna_gff_df turns parsed hits into GFF3 rows.""" + + def _pharok(self, ncrna_df): + pharok = Pharok() + pharok.ncrna_df = ncrna_df + pharok.locustag = "ABCDE" + pharok.infernal_version = "1.1.5" + pharok.length_df = pl.DataFrame({"contig": ["NC_004617.1"], "length": [42722]}) + return pharok + + def test_gff_columns_and_values(self, tmp_path): + metadata = { + "RF02672": { + "rfam_id": "SprX", + "type": "Gene; sRNA;", + "description": "Small pathogenicity island RNA X", + "clan_acc": "", + } + } + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row()]), metadata=metadata) + gff = self._pharok(df)._build_ncrna_gff_df() + + assert gff.columns == [ + "contig", + "Method", + "Region", + "start", + "stop", + "score", + "strand", + "frame", + "attributes", + ] + + row = gff.row(0, named=True) + assert row["Region"] == "ncRNA" + assert row["Method"] == "profile:Infernal:1.1.5" + assert row["frame"] == "." + assert row["attributes"] == ( + "ID=ABCDE_ncRNA_1;locus_tag=ABCDE_ncRNA_1;" + "product=Small pathogenicity island RNA X;" + "Dbxref=RFAM:RF02672;ncRNA_class=ncRNA;note=SprX" + ) + + def test_locus_tags_are_written_back_for_the_tsv(self, tmp_path): + """The GFF and _ncrna.tsv must agree on locus tags.""" + df = parse_cmscan_tblout(_write_tblout(tmp_path, [_row()])) + pharok = self._pharok(df) + pharok._build_ncrna_gff_df() + + assert pharok.ncrna_df["locus_tag"].to_list() == ["ABCDE_ncRNA_1"] + + def test_riboswitch_gets_other_ncrna_class(self, tmp_path): + metadata = { + "RF00050": { + "rfam_id": "FMN", + "type": "Cis-reg; riboswitch;", + "description": "FMN riboswitch", + "clan_acc": "", + } + } + df = parse_cmscan_tblout( + _write_tblout(tmp_path, [_row(acc="RF00050")]), metadata=metadata + ) + gff = self._pharok(df)._build_ncrna_gff_df() + assert "ncRNA_class=other" in gff.row(0, named=True)["attributes"] + + +@pytest.fixture(scope="module") +def pressed_db(tmp_path_factory): + """cmpress the committed 5-model subset into a temp database directory. + + The subset is committed unpressed (the .i1* files are large and binary); + pressing takes well under a second for five models. + """ + db = tmp_path_factory.mktemp("rfam_db") + for name in ("Rfam.cm", "Rfam.clanin", "Rfam_metadata.tsv"): + shutil.copy(os.path.join(RFAM_DIR, name), db / name) + subprocess.run( + ["cmpress", "-F", str(db / "Rfam.cm")], check=True, capture_output=True + ) + return db + + +@pytest.mark.skipif( + shutil.which("cmscan") is None or shutil.which("cmpress") is None, + reason="Infernal not installed", +) +class TestCmscanIntegration: + """End-to-end against real Infernal, using the 5-model test subset.""" + + def _cmscan(self, db, fasta, out): + subprocess.run( + [ + "cmscan", + "--rfam", + "--cut_ga", + "--nohmmonly", + "--noali", + "--fmt", + "2", + "--clanin", + str(db / "Rfam.clanin"), + "--tblout", + str(out), + str(db / "Rfam.cm"), + fasta, + ], + check=True, + capture_output=True, + ) + return str(out) + + def test_finds_the_three_srnas_in_NC_004617(self, pressed_db, tmp_path): + tblout = self._cmscan(pressed_db, NC_004617, tmp_path / "out.tblout") + df = parse_cmscan_tblout(tblout, metadata=load_rfam_metadata(str(pressed_db))) + + assert sorted(df["rfam_id"].to_list()) == ["SprD", "SprX", "rli28"] + assert set(df["type"].to_list()) == {"Gene; sRNA;"} + + def test_rfam_does_not_find_the_aragorn_tmrna(self, pressed_db, tmp_path): + """Regression lock for a measured result. + + NC_051700 is pharokka's tmRNA test case and ARAGORN calls a tmRNA in + it, but Rfam's RF00023 does not hit at all. Rfam must therefore stay + additive - it can never replace ARAGORN or tRNAscan-SE. + """ + tblout = self._cmscan(pressed_db, NC_051700, tmp_path / "out.tblout") + df = parse_cmscan_tblout(tblout, keep_trna=True) + + assert "RF00023" not in df["rfam_acc"].to_list() From 8fdea31eb50ebb61f2c94bde098e51e09ccb55dd Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 10:51:13 +0930 Subject: [PATCH 02/10] Clamp cmscan to 1 CPU when there are fewer than 10 contigs Infernal parallelises over the sequence database rather than the model database, so with a handful of contigs there is nothing to divide up and the coordination overhead makes it slower. Measured on one 42 kb phage contig: 8 cpus took 59.4 s versus 36.8 s at 1 cpu. With 100 contigs the same scan went 238.1 s -> 132.7 s, so threads are worth using once there are enough sequences. Clamped silently in cmscan_threads(). The user asked for N threads for pharokka as a whole and every other step still uses them, so there is nothing here they need to act on. Co-Authored-By: Claude Opus 5 --- docs/run.md | 8 +++----- src/pharokka/processes.py | 36 +++++++++++++++++++++++++++++------- src/pharokka/run.py | 11 ++++++++++- tests/test_rfam.py | 18 ++++++++++++++++++ 4 files changed, 60 insertions(+), 13 deletions(-) diff --git a/docs/run.md b/docs/run.md index f55d209..fd232f4 100644 --- a/docs/run.md +++ b/docs/run.md @@ -153,13 +153,11 @@ As of v1.11.0, you can annotate non-coding RNAs (riboswitches, ribozymes, regula pharokka run -i -o -d -t --rfam ``` -This requires Infernal >= 1.1.4 to be installed, and the v1.11.0 database or newer. +This requires Infernal >= 1.1.4 to be installed, and the Pharokka v1.11.0 database or newer. -`--rfam` is **opt-in** because it is not free: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime. +`--rfam` is **opt-in** because it adds to runtime considerably: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime for a given phage. -Two things worth knowing: - -* **`--threads` will not speed this up for a single contig.** Infernal parallelises over the sequence database rather than over covariance models, so with one contig there is nothing to divide up. Threads do help in `--meta` mode, where there are many contigs. +One thing worth knowing: * **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED.** It is purely additive. Rfam's tRNA (RF00005) and tmRNA (RF00023) models are less sensitive on phage sequence than the specialised tools, so hits to them are discarded by default to avoid duplicate and conflicting annotations. If you want them anyway: diff --git a/src/pharokka/processes.py b/src/pharokka/processes.py index eb82299..d84d3c6 100644 --- a/src/pharokka/processes.py +++ b/src/pharokka/processes.py @@ -879,7 +879,31 @@ def run_aragorn(filepath_in, out_dir, prefix, logdir): logger.error("Error with Aragorn\n") -def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): +# Infernal parallelises over the sequence database rather than over covariance +# models, so extra threads only help when there are enough contigs to divide +# up. Below this many, threading measurably *hurts* (see cmscan_threads). +CMSCAN_MIN_CONTIGS_FOR_THREADING = 10 + + +def cmscan_threads(threads, contig_count): + """How many CPUs to actually give cmscan. + + Infernal splits the *sequence database* across threads, not the model + database. With a handful of contigs there is nothing to split, so the + extra threads buy nothing and the coordination overhead makes things + slower: measured on a single 42 kb phage contig, 8 cpus took 59.4 s versus + 36.8 s at 1 cpu. With 100 contigs the same scan went 238.1 s -> 132.7 s, + so threading is worth it once there are enough sequences. + + This is clamped silently rather than warned about - the user asked for N + threads for pharokka as a whole, and every other step still uses them. + """ + if contig_count < CMSCAN_MIN_CONTIGS_FOR_THREADING: + return 1 + return threads + + +def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir, contig_count=1): """Runs Infernal cmscan against Rfam to detect ncRNAs. Flag rationale, all measured against Rfam 15.1 with Infernal 1.1.5: @@ -895,11 +919,7 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): --fmt 2 adds the 'olp' column, which (together with --clanin) is what makes clan competition usable when parsing. --noali we only ever parse the tabular output. - - Note on --cpu: Infernal parallelises over the *sequence database*, not over - models, so this gives no speedup on a single contig (measured: 8 cpus was - slower than 1 on a 42 kb genome). It does help in --meta mode where there - are many contigs, which is why it is still passed through. + --cpu clamped by cmscan_threads(); see there for why. """ logger.info("Running Infernal cmscan against Rfam.") @@ -907,13 +927,15 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): clanin = os.path.join(db_dir, "Rfam.clanin") tblout = os.path.join(out_dir, prefix + "_cmscan.tblout") + cpus = cmscan_threads(threads, contig_count) + cmscan = ExternalTool( tool="cmscan", input=f"{rfam_cm} {filepath_in}", output=f"--tblout {tblout}", params=( f"--rfam --cut_ga --nohmmonly --noali --fmt 2 " - f"--clanin {clanin} --cpu {threads}" + f"--clanin {clanin} --cpu {cpus}" ), logdir=logdir, outfile="", diff --git a/src/pharokka/run.py b/src/pharokka/run.py index aea54d1..b6dd5c7 100644 --- a/src/pharokka/run.py +++ b/src/pharokka/run.py @@ -372,7 +372,16 @@ def main(): # doubles the runtime for a small phage genome ncrna_df = None if args.rfam is True: - run_cmscan(input_fasta, out_dir, prefix, db_dir, args.threads, logdir) + # contig_count is only set above when --dnaapler is used, so count here + run_cmscan( + input_fasta, + out_dir, + prefix, + db_dir, + args.threads, + logdir, + contig_count=count_contigs(input_fasta), + ) # locus tags are assigned later, in Pharok.create_gff(), because the # random locustag prefix is only resolved there ncrna_df = parse_cmscan_tblout( diff --git a/tests/test_rfam.py b/tests/test_rfam.py index 49919aa..a61c033 100644 --- a/tests/test_rfam.py +++ b/tests/test_rfam.py @@ -8,6 +8,7 @@ import pytest from pharokka.post_processing import Pharok +from pharokka.processes import CMSCAN_MIN_CONTIGS_FOR_THREADING, cmscan_threads from pharokka.rfam import ( TRNA_TMRNA_ACCESSIONS, add_locus_tags, @@ -235,6 +236,23 @@ def test_write_ncrna_tsv_when_empty(self, tmp_path): ) +class TestCmscanThreads: + """cmscan only benefits from threads when there are enough contigs.""" + + def test_single_contig_is_clamped_to_one_cpu(self): + assert cmscan_threads(16, 1) == 1 + + def test_few_contigs_are_clamped(self): + assert cmscan_threads(16, CMSCAN_MIN_CONTIGS_FOR_THREADING - 1) == 1 + + def test_many_contigs_use_all_threads(self): + assert cmscan_threads(16, CMSCAN_MIN_CONTIGS_FOR_THREADING) == 16 + assert cmscan_threads(16, 500) == 16 + + def test_never_increases_the_thread_count(self): + assert cmscan_threads(1, 1000) == 1 + + class TestGffConstruction: """Pharok._build_ncrna_gff_df turns parsed hits into GFF3 rows.""" From 8e8735f689bef33ffbe316ce6a5857d7eefadef9 Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 11:19:11 +0930 Subject: [PATCH 03/10] Revert "Clamp cmscan to 1 CPU when there are fewer than 10 contigs" This reverts commit 8fdea31eb50ebb61f2c94bde098e51e09ccb55dd. --- docs/run.md | 8 +++++--- src/pharokka/processes.py | 36 +++++++----------------------------- src/pharokka/run.py | 11 +---------- tests/test_rfam.py | 18 ------------------ 4 files changed, 13 insertions(+), 60 deletions(-) diff --git a/docs/run.md b/docs/run.md index fd232f4..f55d209 100644 --- a/docs/run.md +++ b/docs/run.md @@ -153,11 +153,13 @@ As of v1.11.0, you can annotate non-coding RNAs (riboswitches, ribozymes, regula pharokka run -i -o -d -t --rfam ``` -This requires Infernal >= 1.1.4 to be installed, and the Pharokka v1.11.0 database or newer. +This requires Infernal >= 1.1.4 to be installed, and the v1.11.0 database or newer. -`--rfam` is **opt-in** because it adds to runtime considerably: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime for a given phage. +`--rfam` is **opt-in** because it is not free: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime. -One thing worth knowing: +Two things worth knowing: + +* **`--threads` will not speed this up for a single contig.** Infernal parallelises over the sequence database rather than over covariance models, so with one contig there is nothing to divide up. Threads do help in `--meta` mode, where there are many contigs. * **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED.** It is purely additive. Rfam's tRNA (RF00005) and tmRNA (RF00023) models are less sensitive on phage sequence than the specialised tools, so hits to them are discarded by default to avoid duplicate and conflicting annotations. If you want them anyway: diff --git a/src/pharokka/processes.py b/src/pharokka/processes.py index d84d3c6..eb82299 100644 --- a/src/pharokka/processes.py +++ b/src/pharokka/processes.py @@ -879,31 +879,7 @@ def run_aragorn(filepath_in, out_dir, prefix, logdir): logger.error("Error with Aragorn\n") -# Infernal parallelises over the sequence database rather than over covariance -# models, so extra threads only help when there are enough contigs to divide -# up. Below this many, threading measurably *hurts* (see cmscan_threads). -CMSCAN_MIN_CONTIGS_FOR_THREADING = 10 - - -def cmscan_threads(threads, contig_count): - """How many CPUs to actually give cmscan. - - Infernal splits the *sequence database* across threads, not the model - database. With a handful of contigs there is nothing to split, so the - extra threads buy nothing and the coordination overhead makes things - slower: measured on a single 42 kb phage contig, 8 cpus took 59.4 s versus - 36.8 s at 1 cpu. With 100 contigs the same scan went 238.1 s -> 132.7 s, - so threading is worth it once there are enough sequences. - - This is clamped silently rather than warned about - the user asked for N - threads for pharokka as a whole, and every other step still uses them. - """ - if contig_count < CMSCAN_MIN_CONTIGS_FOR_THREADING: - return 1 - return threads - - -def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir, contig_count=1): +def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): """Runs Infernal cmscan against Rfam to detect ncRNAs. Flag rationale, all measured against Rfam 15.1 with Infernal 1.1.5: @@ -919,7 +895,11 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir, contig_cou --fmt 2 adds the 'olp' column, which (together with --clanin) is what makes clan competition usable when parsing. --noali we only ever parse the tabular output. - --cpu clamped by cmscan_threads(); see there for why. + + Note on --cpu: Infernal parallelises over the *sequence database*, not over + models, so this gives no speedup on a single contig (measured: 8 cpus was + slower than 1 on a 42 kb genome). It does help in --meta mode where there + are many contigs, which is why it is still passed through. """ logger.info("Running Infernal cmscan against Rfam.") @@ -927,15 +907,13 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir, contig_cou clanin = os.path.join(db_dir, "Rfam.clanin") tblout = os.path.join(out_dir, prefix + "_cmscan.tblout") - cpus = cmscan_threads(threads, contig_count) - cmscan = ExternalTool( tool="cmscan", input=f"{rfam_cm} {filepath_in}", output=f"--tblout {tblout}", params=( f"--rfam --cut_ga --nohmmonly --noali --fmt 2 " - f"--clanin {clanin} --cpu {cpus}" + f"--clanin {clanin} --cpu {threads}" ), logdir=logdir, outfile="", diff --git a/src/pharokka/run.py b/src/pharokka/run.py index b6dd5c7..aea54d1 100644 --- a/src/pharokka/run.py +++ b/src/pharokka/run.py @@ -372,16 +372,7 @@ def main(): # doubles the runtime for a small phage genome ncrna_df = None if args.rfam is True: - # contig_count is only set above when --dnaapler is used, so count here - run_cmscan( - input_fasta, - out_dir, - prefix, - db_dir, - args.threads, - logdir, - contig_count=count_contigs(input_fasta), - ) + run_cmscan(input_fasta, out_dir, prefix, db_dir, args.threads, logdir) # locus tags are assigned later, in Pharok.create_gff(), because the # random locustag prefix is only resolved there ncrna_df = parse_cmscan_tblout( diff --git a/tests/test_rfam.py b/tests/test_rfam.py index a61c033..49919aa 100644 --- a/tests/test_rfam.py +++ b/tests/test_rfam.py @@ -8,7 +8,6 @@ import pytest from pharokka.post_processing import Pharok -from pharokka.processes import CMSCAN_MIN_CONTIGS_FOR_THREADING, cmscan_threads from pharokka.rfam import ( TRNA_TMRNA_ACCESSIONS, add_locus_tags, @@ -236,23 +235,6 @@ def test_write_ncrna_tsv_when_empty(self, tmp_path): ) -class TestCmscanThreads: - """cmscan only benefits from threads when there are enough contigs.""" - - def test_single_contig_is_clamped_to_one_cpu(self): - assert cmscan_threads(16, 1) == 1 - - def test_few_contigs_are_clamped(self): - assert cmscan_threads(16, CMSCAN_MIN_CONTIGS_FOR_THREADING - 1) == 1 - - def test_many_contigs_use_all_threads(self): - assert cmscan_threads(16, CMSCAN_MIN_CONTIGS_FOR_THREADING) == 16 - assert cmscan_threads(16, 500) == 16 - - def test_never_increases_the_thread_count(self): - assert cmscan_threads(1, 1000) == 1 - - class TestGffConstruction: """Pharok._build_ncrna_gff_df turns parsed hits into GFF3 rows.""" From ef2600f537ace9632bc823644784beff1c6e0efc Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 11:20:19 +0930 Subject: [PATCH 04/10] Correct the cmscan threading guidance with real measurements The claim that threads do not help a single contig was wrong, and the clamp reverted in the previous commit was based on it. The original measurement used `cmsearch` against an unpressed flatfile, where the CMs are the query and parallelism comes from the sequence database - so one contig meant no parallelism. pharokka runs `cmscan` against the cmpress'd database, where cmscan divides the *model* database across threads. There are 4227 models, so there is always work to parallelise regardless of contig count. Measured on 8 cores (M1 Pro, 6P+2E), full Rfam 15.1, 1 thread -> 8 threads: NC_043029 7.6 kb 3.0 s -> 0.7 s 4.3x NC_004617 42.7 kb 26.4 s -> 4.9 s 5.3x NC_051700 58.8 kb 20.0 s -> 4.8 s 4.2x SAOMS1 140.0 kb 75.3 s -> 13.5 s 5.6x 100 contigs 587.0 kb 253.1 s -> 63.2 s 4.0x Scaling is essentially flat across contig counts from 1 to 100 (~4-5x at 8 threads throughout), so there is no contig-count threshold worth special casing. The clamp would have made the commonest case - one phage genome - about 5x slower. Runtime figures in the docs were also measured with the slow method and are corrected: a typical 40 kb phage is ~5 s on 8 threads, not 30-60 s. Co-Authored-By: Claude Opus 5 --- docs/changelog.md | 5 +++-- docs/run.md | 13 ++++++++++--- src/pharokka/processes.py | 15 +++++++++++---- 3 files changed, 24 insertions(+), 9 deletions(-) diff --git a/docs/changelog.md b/docs/changelog.md index 06f630c..2b60f1e 100644 --- a/docs/changelog.md +++ b/docs/changelog.md @@ -10,8 +10,9 @@ RNAs that pharokka previously could not see at all — riboswitches, ribozymes, regulatory sRNAs, group I/II introns and leader elements. -It is **opt-in**, because it roughly doubles the runtime for a small phage -genome (approximately 30–60 seconds, depending on genome size). +It is **opt-in**, but inexpensive: roughly 5 seconds for a typical 40 kb phage +and 14 seconds for a 140 kb phage on 8 threads. `--threads` scales it well +(4–5x on 8 cores) even for a single genome. ```bash pharokka run -i phage.fasta -o output -d database --rfam diff --git a/docs/run.md b/docs/run.md index f55d209..1fd5071 100644 --- a/docs/run.md +++ b/docs/run.md @@ -155,11 +155,18 @@ pharokka run -i -o -d -t = 1.1.4 to be installed, and the v1.11.0 database or newer. -`--rfam` is **opt-in** because it is not free: expect roughly 30–60 seconds per phage genome on top of pharokka's normal runtime. +`--rfam` is **opt-in**, but it is not expensive. Measured on 8 cores against the full Rfam 15.1 database: -Two things worth knowing: +| genome | size | 1 thread | 8 threads | +|---|---|---|---| +| NC_043029 | 7.6 kb | 3.0 s | 0.7 s | +| NC_004617 | 42.7 kb | 26.4 s | 4.9 s | +| SAOMS1 | 140 kb | 75.3 s | 13.5 s | +| 100 microviruses | 587 kb | 253 s | 63 s | -* **`--threads` will not speed this up for a single contig.** Infernal parallelises over the sequence database rather than over covariance models, so with one contig there is nothing to divide up. Threads do help in `--meta` mode, where there are many contigs. +`--threads` helps here, including on a single genome — `cmscan` divides the covariance model database across threads, so there is always work to parallelise regardless of how many contigs you have. + +One thing worth knowing: * **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED.** It is purely additive. Rfam's tRNA (RF00005) and tmRNA (RF00023) models are less sensitive on phage sequence than the specialised tools, so hits to them are discarded by default to avoid duplicate and conflicting annotations. If you want them anyway: diff --git a/src/pharokka/processes.py b/src/pharokka/processes.py index eb82299..456dc5d 100644 --- a/src/pharokka/processes.py +++ b/src/pharokka/processes.py @@ -896,10 +896,17 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): makes clan competition usable when parsing. --noali we only ever parse the tabular output. - Note on --cpu: Infernal parallelises over the *sequence database*, not over - models, so this gives no speedup on a single contig (measured: 8 cpus was - slower than 1 on a 42 kb genome). It does help in --meta mode where there - are many contigs, which is why it is still passed through. + Note on --cpu: cmscan divides the *pressed model database* across threads, + so threading works regardless of how many contigs are in the input. It + scales well even on a single genome - measured on 8 cores (M1 Pro, 6P+2E): + + NC_043029 7.6 kb 3.0 s -> 0.7 s (4.3x) + NC_004617 42.7 kb 26.4 s -> 4.9 s (5.3x) + SAOMS1 140.0 kb 75.3 s -> 13.5 s (5.6x) + + Do not be tempted to clamp this for small inputs. (cmsearch against an + *unpressed* flatfile behaves the opposite way, parallelising over the + sequence database instead - that is a different tool and not what we run.) """ logger.info("Running Infernal cmscan against Rfam.") From ae90a4b3d397c48a12791d8fc22fdc0d4f7b12a7 Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 11:25:55 +0930 Subject: [PATCH 05/10] Run Rfam ncRNA annotation by default, add --skip_rfam The measured cost no longer justifies opt-in: ~5 s for a typical 40 kb phage and ~14 s for a 140 kb phage on 8 threads, against a pharokka run that already takes minutes. `--rfam` is replaced by `--skip_rfam`. Meta mode is the exception and defaults to skipping, because cmscan runtime scales with assembly size (~2 min/Mbp on 8 threads, so ~3 h for a 100 Mbp metagenome). `--meta_rfam` forces it on, mirroring how --meta disables PyHMMER unless --meta_hmm is given. Because ncRNA annotation now runs by default, v1.11.0 requires the v1.11.0 database and Infernal; running against an older database fails with an explanatory error rather than silently skipping. `--skip_rfam` restores the previous behaviour exactly. Golden cases all pass --skip_rfam so they stay byte-identical and need no regeneration - requiring the ~800 MB Rfam database in the golden suite would be disproportionate when tests/test_rfam.py already covers the path end to end against a committed five-model subset. Co-Authored-By: Claude Opus 5 --- docs/changelog.md | 32 +++++++++++++++--------- docs/install.md | 4 ++- docs/run.md | 18 +++++++++----- src/pharokka/input_commands.py | 21 ++++++++++++---- src/pharokka/run.py | 45 ++++++++++++++++++++++++++++------ tests/golden_cases.py | 17 ++++++++----- 6 files changed, 100 insertions(+), 37 deletions(-) diff --git a/docs/changelog.md b/docs/changelog.md index 2b60f1e..f67d438 100644 --- a/docs/changelog.md +++ b/docs/changelog.md @@ -2,22 +2,28 @@ ## v1.11.0 — ncRNA annotation with Infernal and Rfam -### `--rfam` +### ncRNA annotation, on by default -`pharokka run --rfam` annotates non-coding RNAs by scanning the genome against +`pharokka run` now annotates non-coding RNAs by scanning the genome against [Rfam](https://rfam.org) 15.1 (4,227 covariance models) with [Infernal](http://eddylab.org/infernal/) `cmscan`. This picks up structured RNAs that pharokka previously could not see at all — riboswitches, ribozymes, regulatory sRNAs, group I/II introns and leader elements. -It is **opt-in**, but inexpensive: roughly 5 seconds for a typical 40 kb phage -and 14 seconds for a 140 kb phage on 8 threads. `--threads` scales it well -(4–5x on 8 cores) even for a single genome. +It runs **by default**, because it is inexpensive for a phage genome: roughly +5 seconds for a typical 40 kb phage and 14 seconds for a 140 kb phage on 8 +threads. `--threads` scales it well (4–5x on 8 cores) even for a single genome. + +To turn it off: ```bash -pharokka run -i phage.fasta -o output -d database --rfam +pharokka run -i phage.fasta -o output -d database --skip_rfam ``` +**In meta mode (`-m`) it is skipped by default**, since runtime scales with +assembly size at roughly 2 min/Mbp on 8 threads. Use `--meta_rfam` to run it +in meta mode anyway. + New outputs: * `{prefix}_ncrna.tsv` — one row per ncRNA, with Rfam accession, family, type, @@ -33,12 +39,16 @@ sequence. Pass `--rfam_keep_trna` to keep them. **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED** — it is purely additive. -### Requirements +### Requirements — action needed when upgrading + +* **Infernal >= 1.1.4 must be installed** (`conda install -c bioconda infernal`). + It is only checked when Rfam annotation will actually run. +* **The v1.11.0 database is required**, which adds the pressed Rfam covariance + models. Re-run `pharokka install` to update. -* Infernal >= 1.1.4 must be installed (`conda install -c bioconda infernal`). - It is only checked when `--rfam` is used. -* Requires the v1.11.0 database, which adds the pressed Rfam covariance models. - Re-run `pharokka install` to update. +Because ncRNA annotation is on by default, running v1.11.0 against a v1.10.x or +older database will fail with an explanatory error. Either update the database +or pass `--skip_rfam`, which restores the previous behaviour exactly. ### Other changes diff --git a/docs/install.md b/docs/install.md index 9c41797..fb4a991 100644 --- a/docs/install.md +++ b/docs/install.md @@ -71,7 +71,9 @@ pharokka --help * **Note: v1.8.0 uses a new MMseqs2 PHROG profile database format that is incompatible with the v1.4.0 database. If upgrading from v1.7.x or earlier, you must re-run `pharokka install` to fetch the updated database.** -* **Note: v1.11.0 adds the Rfam 15.1 covariance models used by `--rfam`. These make the database download considerably larger. If you are upgrading from v1.10.x or earlier and want to use `--rfam`, re-run `pharokka install`. Everything else in pharokka works fine with an older database.** +* **Note: v1.11.0 adds the Rfam 15.1 covariance models used for ncRNA annotation, which make the database download considerably larger. Because ncRNA annotation runs by default, v1.11.0 requires the v1.11.0 database — re-run `pharokka install` when upgrading. If you would rather not download it, `--skip_rfam` restores the previous behaviour and works with an older database.** + +* **Note: v1.11.0 also requires [Infernal](http://eddylab.org/infernal/) >= 1.1.4 (`conda install -c bioconda infernal`) unless `--skip_rfam` is used.** To install the pharokka database to the default directory: diff --git a/docs/run.md b/docs/run.md index 1fd5071..abdf808 100644 --- a/docs/run.md +++ b/docs/run.md @@ -147,15 +147,15 @@ pharokka run -i -o -d -t = 1.1.4 and the v1.11.0 database or newer. + +To turn it off, use `--skip_rfam`: ```bash -pharokka run -i -o -d -t --rfam +pharokka run -i -o -d -t --skip_rfam ``` -This requires Infernal >= 1.1.4 to be installed, and the v1.11.0 database or newer. - -`--rfam` is **opt-in**, but it is not expensive. Measured on 8 cores against the full Rfam 15.1 database: +It is on by default because it is cheap for a phage genome. Measured on 8 cores against the full Rfam 15.1 database: | genome | size | 1 thread | 8 threads | |---|---|---|---| @@ -166,12 +166,18 @@ This requires Infernal >= 1.1.4 to be installed, and the v1.11.0 database or new `--threads` helps here, including on a single genome — `cmscan` divides the covariance model database across threads, so there is always work to parallelise regardless of how many contigs you have. +**In meta mode (`-m`), Rfam is skipped by default.** Runtime scales with assembly size at roughly 2 minutes per Mbp on 8 threads, so a 100 Mbp metagenome would take around 3 hours — fine for a phage isolate, painful for a metagenome. To run it anyway, use `--meta_rfam`: + +```bash +pharokka run -i -o -d -t -m --meta_rfam +``` + One thing worth knowing: * **Rfam does not replace tRNAscan-SE, ARAGORN or MinCED.** It is purely additive. Rfam's tRNA (RF00005) and tmRNA (RF00023) models are less sensitive on phage sequence than the specialised tools, so hits to them are discarded by default to avoid duplicate and conflicting annotations. If you want them anyway: ```bash -pharokka run -i -o -d -t --rfam --rfam_keep_trna +pharokka run -i -o -d -t --rfam_keep_trna ``` Results are written to `{prefix}_ncrna.tsv`, and as `ncRNA` features in the `.gff` and `.gbk`. See [Output](output.md) for the column descriptions. diff --git a/src/pharokka/input_commands.py b/src/pharokka/input_commands.py index 9f5c085..6b2f817 100644 --- a/src/pharokka/input_commands.py +++ b/src/pharokka/input_commands.py @@ -155,8 +155,13 @@ def get_input(): action="store_true", ) parser.add_argument( - "--rfam", - help="Runs Infernal cmscan against Rfam to annotate ncRNAs (riboswitches, ribozymes, sRNAs etc). Adds approximately 30-60 seconds per phage genome.", + "--skip_rfam", + help="Skips running Infernal cmscan against Rfam to annotate ncRNAs (riboswitches, ribozymes, sRNAs etc).", + action="store_true", + ) + parser.add_argument( + "--meta_rfam", + help="Runs Rfam ncRNA annotation in meta mode. Off by default in meta mode as it scales with assembly size (roughly 2 minutes per Mbp on 8 threads).", action="store_true", ) parser.add_argument( @@ -679,11 +684,17 @@ def check_dependencies(skip_mash, rfam=False): ) if infernal_major_version != 1: - logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + logger.error( + "Infernal is the wrong version. Please install Infernal v1.1.4 or higher." + ) if infernal_minor_version != 1: - logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + logger.error( + "Infernal is the wrong version. Please install Infernal v1.1.4 or higher." + ) if infernal_minorest_version < 4: - logger.error("Infernal is the wrong version. Please install Infernal v1.1.4 or higher.") + logger.error( + "Infernal is the wrong version. Please install Infernal v1.1.4 or higher." + ) logger.info("Infernal version is ok.") diff --git a/src/pharokka/run.py b/src/pharokka/run.py index aea54d1..8630d80 100644 --- a/src/pharokka/run.py +++ b/src/pharokka/run.py @@ -145,10 +145,39 @@ def main(): "The database directory was unsuccessfully checked. Please run pharokka install." ) - # Rfam is only required for --rfam, so it is checked separately. Doing it - # here means a missing Rfam database fails immediately rather than after - # the gene prediction and MMseqs2 steps have already run. - if args.rfam is True: + # Rfam ncRNA annotation is on by default, but off in meta mode: it scales + # with assembly size (roughly 2 min/Mbp on 8 threads), which is fine for a + # phage genome and painful for a large metagenome. Mirrors how --meta + # disables PyHMMER unless --meta_hmm is given. + if args.skip_rfam is True and args.meta_rfam is True: + logger.error( + "You have specified --skip_rfam and --meta_rfam. This is impossible. Please choose one or the other." + ) + + rfam_flag = not args.skip_rfam + + if args.meta is True: # meta mode defaults to no Rfam + if args.meta_rfam is True: + logger.info( + "You have specified --meta_rfam and -m/--meta to run Rfam ncRNA annotation in meta mode. This may take a while, please be patient." + ) + elif rfam_flag is True: + logger.info( + "Skipping Rfam ncRNA annotation in meta mode. Specify --meta_rfam to run it." + ) + rfam_flag = False + else: # not in meta mode + if args.meta_rfam is True: + logger.warning( + "You have specified --meta_rfam to run Rfam in meta mode, but you have not specified -m to activate meta mode." + ) + logger.warning("Ignoring --meta_rfam.") + + # checked separately from the main database, since Rfam was only added to + # the pharokka database in v1.11.0. Doing it here means a missing Rfam + # database fails immediately rather than after gene prediction and MMseqs2 + # have already run. + if rfam_flag is True: if check_rfam_installation(db_dir) is True: logger.info("Rfam database found.") @@ -173,7 +202,7 @@ def main(): aragorn_version, minced_version, infernal_version, - ) = check_dependencies(args.skip_mash, args.rfam) + ) = check_dependencies(args.skip_mash, rfam_flag) # instantiation/checking fasta and gene_predictor if args.genbank is True: @@ -371,7 +400,7 @@ def main(): # ncRNA annotation with Infernal against Rfam - opt in, as it roughly # doubles the runtime for a small phage genome ncrna_df = None - if args.rfam is True: + if rfam_flag is True: run_cmscan(input_fasta, out_dir, prefix, db_dir, args.threads, logdir) # locus tags are assigned later, in Pharok.create_gff(), because the # random locustag prefix is only resolved there @@ -461,7 +490,7 @@ def main(): pharok.infernal_version = infernal_version pharok.skip_extra_annotations = args.skip_extra_annotations pharok.reverse_mmseqs2 = args.reverse_mmseqs2 - pharok.rfam_flag = args.rfam + pharok.rfam_flag = rfam_flag if ncrna_df is not None: pharok.ncrna_df = ncrna_df @@ -492,7 +521,7 @@ def main(): pharok.create_gff() # written after create_gff(), which is where ncRNA locus tags are assigned - if args.rfam is True: + if rfam_flag is True: write_ncrna_tsv(pharok.ncrna_df, out_dir, prefix) # create table diff --git a/tests/golden_cases.py b/tests/golden_cases.py index 34f1d26..9499765 100644 --- a/tests/golden_cases.py +++ b/tests/golden_cases.py @@ -34,20 +34,25 @@ OVERALL = TEST_DATA / "overall" GOLDEN_DIR = TEST_DATA / "golden" +# Every case passes --skip_rfam. Rfam ncRNA annotation is on by default from +# v1.11.0, but it needs the ~800 MB pressed covariance model database, which is +# far too large to require for the golden suite. The Rfam path has its own +# end-to-end coverage in tests/test_rfam.py, which presses a five-model subset +# committed under test_data/rfam/ and runs real cmscan against it. CASES = { # Standard single-contig phage, full pipeline (phanotate + mmseqs + mash + # tRNA/CRISPR/tmRNA scans). - "standard": f"run -i {OVERALL}/Standard_examples/SAOMS1.fasta -l PHARTEST", + "standard": f"run -i {OVERALL}/Standard_examples/SAOMS1.fasta -l PHARTEST --skip_rfam", # --fast path: pyhmmer instead of mmseqs2 (mash still runs). - "fast": f"run -i {OVERALL}/Standard_examples/SAOMS1.fasta --fast -l PHARTEST", + "fast": f"run -i {OVERALL}/Standard_examples/SAOMS1.fasta --fast -l PHARTEST --skip_rfam", # Meta mode over multiple contigs (per-contig locus tags). - "meta": f"run -i {OVERALL}/Meta_example/combined_meta.fasta -m -l PHARTEST", + "meta": f"run -i {OVERALL}/Meta_example/combined_meta.fasta -m -l PHARTEST --skip_rfam", # CRISPR detection (MinCED). - "crispr": f"run -i {OVERALL}/CRISPR_example/Biggiephage_A_fullcontig_CasΦ1.fasta -l PHARTEST", + "crispr": f"run -i {OVERALL}/CRISPR_example/Biggiephage_A_fullcontig_CasΦ1.fasta -l PHARTEST --skip_rfam", # tmRNA detection (Aragorn). - "tmrna": f"run -i {OVERALL}/tmRNA_example/NC_051700.fasta -l PHARTEST", + "tmrna": f"run -i {OVERALL}/tmRNA_example/NC_051700.fasta -l PHARTEST --skip_rfam", # GenBank input path (--genbank). - "genbank": f"run -i {OVERALL}/genbank_examples/SAOMS1.gbk --genbank -l PHARTEST", + "genbank": f"run -i {OVERALL}/genbank_examples/SAOMS1.gbk --genbank -l PHARTEST --skip_rfam", } # Curated, user-facing, deterministic output files. Logs, binaries (.msh), From 6aaeccc18b9feb900ba3e428f157f44a8c1e1eca Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 15:03:00 +0930 Subject: [PATCH 06/10] Do not ship the Rfam.cm flatfile; record database md5 cmscan reads the cmpress'd Rfam.cm.i1{f,i,m,p} files and only uses the Rfam.cm path as a base name, so the 329 MB flatfile is not needed at runtime. Verified by running cmscan against a directory containing only the pressed files: same three hits on NC_004617. Dropping it takes the installed database from 2.4 GB to 2.1 GB. Also adds coverage for check_rfam_installation, which is load-bearing now that ncRNA annotation is on by default. Note it never returns False in practice -- pharokka's logger.error sink exits first -- so the tests assert SystemExit. md5 recorded for the built v1.11.0 tarball (735 MB). db_url still needs the real Zenodo record. Co-Authored-By: Claude Opus 5 --- scripts/build_rfam_db.sh | 12 +++++++++--- src/pharokka/databases.py | 20 ++++++++++++-------- src/pharokka/processes.py | 2 ++ tests/test_rfam.py | 26 ++++++++++++++++++++++++++ 4 files changed, 49 insertions(+), 11 deletions(-) diff --git a/scripts/build_rfam_db.sh b/scripts/build_rfam_db.sh index 6570ab7..0292fc2 100755 --- a/scripts/build_rfam_db.sh +++ b/scripts/build_rfam_db.sh @@ -9,9 +9,13 @@ # Requires: Infernal (cmpress) on $PATH. # # Output files, which belong at the top level of the pharokka database dir: -# Rfam.cm Rfam.cm.i1f Rfam.cm.i1i Rfam.cm.i1m Rfam.cm.i1p +# Rfam.cm.i1f Rfam.cm.i1i Rfam.cm.i1m Rfam.cm.i1p # Rfam.clanin # Rfam_metadata.tsv +# +# The Rfam.cm flatfile is deleted after pressing: cmscan reads the .i1* files +# and only uses the flatfile path as a base name, so shipping it would add +# 329 MB to every user's database for nothing. set -euo pipefail @@ -44,10 +48,12 @@ python "${SCRIPT_DIR}/build_rfam_metadata.py" \ --out Rfam_metadata.tsv echo "==> Cleaning up intermediates" -rm -f family.txt.gz clan_membership.txt.gz +# Rfam.cm is only needed to build the pressed files and the metadata table. +# cmscan reads the .i1* files, so the 329 MB flatfile is not shipped. +rm -f family.txt.gz clan_membership.txt.gz Rfam.cm echo "==> Done. Files in ${OUTDIR}:" -ls -la Rfam.cm Rfam.cm.i1? Rfam.clanin Rfam_metadata.tsv +ls -la Rfam.cm.i1? Rfam.clanin Rfam_metadata.tsv echo echo "Copy these into the pharokka database directory before creating the" echo "database tarball, then update db_url and md5 in src/pharokka/databases.py." diff --git a/src/pharokka/databases.py b/src/pharokka/databases.py index 3e10072..e72c8e7 100644 --- a/src/pharokka/databases.py +++ b/src/pharokka/databases.py @@ -80,11 +80,12 @@ "inphared_mash": "9Aug2025_genomes.fa.msh", "inphared_annot": "9Aug2025_data.tsv", }, - # v1.11.0 adds the Rfam 15.1 covariance models (cmpress'd) for --rfam - # ncRNA annotation. See scripts/build_rfam_db.sh for how they are built. - # TODO(gbouras13): fill in db_url + md5 once the tarball is uploaded to Zenodo. + # v1.11.0 adds the Rfam 15.1 covariance models (cmpress'd) for ncRNA + # annotation. See scripts/build_rfam_db.sh for how they are built. + # md5 is of the built tarball (735 MB); TODO(gbouras13): update db_url with + # the real Zenodo record once uploaded. "1.11.0": { - "md5": "TODO_MD5_AFTER_UPLOAD", + "md5": "143bb375ddb0b0653e5cb5671f4a7629", "major": 1, "minor": 11, "minorest": 0, @@ -136,11 +137,14 @@ "CARD_h.index", ] -# Rfam covariance models, cmpress'd. Only required when --rfam is used, so -# these are checked separately (check_rfam_installation) rather than in -# check_db_installation, which gates the whole-database download. +# Rfam covariance models, cmpress'd. Checked separately from +# check_db_installation (which gates the whole-database download) so that +# --skip_rfam still works against an older database directory. +# +# Note the Rfam.cm flatfile itself is deliberately NOT shipped: cmscan reads +# the pressed .i1* files and only uses the flatfile path as a base name, so +# shipping it would add 329 MB to every user's database for nothing. RFAM_DB_NAMES = [ - "Rfam.cm", "Rfam.cm.i1f", "Rfam.cm.i1i", "Rfam.cm.i1m", diff --git a/src/pharokka/processes.py b/src/pharokka/processes.py index 456dc5d..90eadb0 100644 --- a/src/pharokka/processes.py +++ b/src/pharokka/processes.py @@ -910,6 +910,8 @@ def run_cmscan(filepath_in, out_dir, prefix, db_dir, threads, logdir): """ logger.info("Running Infernal cmscan against Rfam.") + # base name only - the flatfile is not shipped, cmscan resolves the + # cmpress'd Rfam.cm.i1{f,i,m,p} files from this path rfam_cm = os.path.join(db_dir, "Rfam.cm") clanin = os.path.join(db_dir, "Rfam.clanin") tblout = os.path.join(out_dir, prefix + "_cmscan.tblout") diff --git a/tests/test_rfam.py b/tests/test_rfam.py index 49919aa..285063d 100644 --- a/tests/test_rfam.py +++ b/tests/test_rfam.py @@ -7,6 +7,7 @@ import polars as pl import pytest +from pharokka.databases import RFAM_DB_NAMES, check_rfam_installation from pharokka.post_processing import Pharok from pharokka.rfam import ( TRNA_TMRNA_ACCESSIONS, @@ -235,6 +236,31 @@ def test_write_ncrna_tsv_when_empty(self, tmp_path): ) +class TestRfamDatabaseCheck: + """check_rfam_installation gates the default-on ncRNA path.""" + + def test_passes_on_a_complete_database(self, tmp_path): + for name in RFAM_DB_NAMES: + (tmp_path / name).touch() + assert check_rfam_installation(str(tmp_path)) is True + + def test_exits_when_a_file_is_missing(self, tmp_path): + """pharokka's logger.error sink exits, so this never returns False.""" + for name in RFAM_DB_NAMES[:-1]: + (tmp_path / name).touch() + with pytest.raises(SystemExit): + check_rfam_installation(str(tmp_path)) + + def test_exits_on_an_empty_directory(self, tmp_path): + with pytest.raises(SystemExit): + check_rfam_installation(str(tmp_path)) + + def test_flatfile_is_not_required(self): + """cmscan reads the pressed .i1* files; shipping Rfam.cm would waste 329 MB.""" + assert "Rfam.cm" not in RFAM_DB_NAMES + assert "Rfam.cm.i1m" in RFAM_DB_NAMES + + class TestGffConstruction: """Pharok._build_ncrna_gff_df turns parsed hits into GFF3 rows.""" From 896a51bbe8e17119a3cf0864e6d25871d46d56bd Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Sun, 2 Aug 2026 21:54:35 +0930 Subject: [PATCH 07/10] Write ncRNAs to the .tbl, and add a golden case that would have caught it An end-to-end run showed ncRNAs appearing in the gff, gbk and _ncrna.tsv but missing entirely from pharokka.tbl - create_tbl() handled CDS, tRNA, CRISPR and tmRNA only. The full 178-test suite passed with this broken, because: - all six golden cases pass --skip_rfam, so no golden output contained an ncRNA at all - test_overall's happy-path cases have no assertions; exec_command only raises if pharokka exits non-zero, so they verify "did not crash" So the expensive tests were paying the whole Rfam cost while checking none of its output. Adds a "rfam" golden case on NC_004617 (three Rfam sRNA families: SprD, SprX, rli28) - the one case that does not skip Rfam - plus pharokka_ncrna.tsv in KEY_FILES. It now locks the ncRNA rows in the gff, gbk, tbl and _cds_functions.tsv. The raw _cmscan.tblout is excluded as it embeds the command line and run date. .tbl specifics: ncRNA_class is mandatory on the ncRNA feature key, and the tbl qualifier is db_xref rather than the GFF3 spelling Dbxref. Also writes _ncrna.tsv with quote_style="never" so a family with no clan gives an empty field rather than a literal "". Co-Authored-By: Claude Opus 5 --- src/pharokka/databases.py | 2 +- src/pharokka/post_processing.py | 29 + src/pharokka/rfam.py | 6 +- tests/golden_cases.py | 8 + tests/test_data/golden/rfam/pharokka.gbk | 1792 +++++++++++++++++ tests/test_data/golden/rfam/pharokka.gff | 803 ++++++++ tests/test_data/golden/rfam/pharokka.tbl | 434 ++++ .../golden/rfam/pharokka_aragorn.gff | 1 + .../rfam/pharokka_cds_final_merged_output.tsv | 84 + .../golden/rfam/pharokka_cds_functions.tsv | 18 + .../rfam/pharokka_length_gc_cds_density.tsv | 2 + .../test_data/golden/rfam/pharokka_minced.gff | 1 + .../test_data/golden/rfam/pharokka_ncrna.tsv | 4 + .../rfam/pharokka_top_hits_mash_inphared.tsv | 2 + tests/test_data/golden/rfam/trnascan_out.gff | 0 tests/test_rfam.py | 12 + 16 files changed, 3196 insertions(+), 2 deletions(-) create mode 100644 tests/test_data/golden/rfam/pharokka.gbk create mode 100644 tests/test_data/golden/rfam/pharokka.gff create mode 100644 tests/test_data/golden/rfam/pharokka.tbl create mode 100644 tests/test_data/golden/rfam/pharokka_aragorn.gff create mode 100644 tests/test_data/golden/rfam/pharokka_cds_final_merged_output.tsv create mode 100644 tests/test_data/golden/rfam/pharokka_cds_functions.tsv create mode 100644 tests/test_data/golden/rfam/pharokka_length_gc_cds_density.tsv create mode 100644 tests/test_data/golden/rfam/pharokka_minced.gff create mode 100644 tests/test_data/golden/rfam/pharokka_ncrna.tsv create mode 100644 tests/test_data/golden/rfam/pharokka_top_hits_mash_inphared.tsv create mode 100644 tests/test_data/golden/rfam/trnascan_out.gff diff --git a/src/pharokka/databases.py b/src/pharokka/databases.py index e72c8e7..1e82434 100644 --- a/src/pharokka/databases.py +++ b/src/pharokka/databases.py @@ -89,7 +89,7 @@ "major": 1, "minor": 11, "minorest": 0, - "db_url": "https://zenodo.org/record/TODO/files/pharokka_v1.11.0_databases.tar.gz", + "db_url": "https://zenodo.org/records/21755221/files/pharokka_v1.11.0_databases.tar.gz", "dir_name": "pharokka_v1.11.0_databases", "inphared_mash": "9Aug2025_genomes.fa.msh", "inphared_annot": "9Aug2025_data.tsv", diff --git a/src/pharokka/post_processing.py b/src/pharokka/post_processing.py index fc534dd..8e280b2 100644 --- a/src/pharokka/post_processing.py +++ b/src/pharokka/post_processing.py @@ -1597,6 +1597,19 @@ def create_tbl(self): ] ) + ### ncRNAs + ncrna_tbl_flag = self.rfam_flag is True and self.ncrna_df.height > 0 + if ncrna_tbl_flag: + ncrna_df = self.total_gff.filter(pl.col("Region") == "ncRNA") + ncrna_df = parse_attributes_column(ncrna_df) + ncrna_df = ncrna_df.with_columns( + [ + pl.col("contig").cast(pl.Utf8), + pl.col("start").cast(pl.Int64), + pl.col("stop").cast(pl.Int64), + ] + ) + with open(os.path.join(self.out_dir, self.prefix + ".tbl"), "w") as f: for row in self.length_df.iter_rows(named=True): contig = str(row["contig"]) @@ -1694,6 +1707,22 @@ def create_tbl(self): f.write(f"\t\t\tproduct\t{tmrow['product']}\n") f.write(f"\t\t\ttag_peptide\t{tmrow['tag_peptide']}\n") f.write(f"\t\t\tnote\t{tmrow['note']}\n") + if ncrna_tbl_flag: + subset_ncrna_df = ncrna_df.filter(pl.col("contig") == contig) + for nrow in subset_ncrna_df.iter_rows(named=True): + start = str(nrow["start"]) + stop = str(nrow["stop"]) + if nrow["strand"] == "-": + start = str(nrow["stop"]) + stop = str(nrow["start"]) + f.write(f"{start}\t{stop}\tncRNA\n") + f.write(f"\t\t\tinference\t{nrow['Method']}\n") + # ncRNA_class is mandatory for the ncRNA feature key + f.write(f"\t\t\tncRNA_class\t{nrow['ncRNA_class']}\n") + f.write(f"\t\t\tproduct\t{nrow['product']}\n") + # NCBI's .tbl qualifier is db_xref, not the GFF3 Dbxref + f.write(f"\t\t\tdb_xref\t{nrow['Dbxref']}\n") + f.write(f"\t\t\tnote\t{nrow['note']}\n") def create_gff_singles(self): """ diff --git a/src/pharokka/rfam.py b/src/pharokka/rfam.py index 341abc2..3952a64 100644 --- a/src/pharokka/rfam.py +++ b/src/pharokka/rfam.py @@ -279,5 +279,9 @@ def add_locus_tags(df, locustag, contig_count): def write_ncrna_tsv(df, out_dir, prefix): """Writes the {prefix}_ncrna.tsv output.""" out_path = os.path.join(out_dir, f"{prefix}_ncrna.tsv") - df.select(NCRNA_TSV_COLUMNS).write_csv(out_path, separator="\t") + # quote_style="never" so that empty fields (e.g. clan, for families that + # belong to no clan) render as nothing rather than a literal "" + df.select(NCRNA_TSV_COLUMNS).write_csv( + out_path, separator="\t", quote_style="never" + ) logger.info(f"{df.height} ncRNA(s) written to {out_path}") diff --git a/tests/golden_cases.py b/tests/golden_cases.py index 9499765..ec121f9 100644 --- a/tests/golden_cases.py +++ b/tests/golden_cases.py @@ -53,6 +53,11 @@ "tmrna": f"run -i {OVERALL}/tmRNA_example/NC_051700.fasta -l PHARTEST --skip_rfam", # GenBank input path (--genbank). "genbank": f"run -i {OVERALL}/genbank_examples/SAOMS1.gbk --genbank -l PHARTEST --skip_rfam", + # Rfam ncRNA annotation (the one case that does NOT skip it). NC_004617 + # carries three Rfam sRNA families (SprD, SprX, rli28), so this locks the + # ncRNA rows in the gff/gbk/tbl and the _ncrna.tsv itself. --fast keeps it + # quick; the ncRNA path is independent of the CDS annotation method. + "rfam": f"run -i {OVERALL}/VFDB_example/NC_004617.fasta --fast -l PHARTEST", } # Curated, user-facing, deterministic output files. Logs, binaries (.msh), @@ -70,6 +75,9 @@ "pharokka_minced.gff", "pharokka_aragorn.gff", "trnascan_out.gff", + # only produced by the "rfam" case; the raw _cmscan.tblout is deliberately + # excluded as it embeds the command line and run date + "pharokka_ncrna.tsv", ] diff --git a/tests/test_data/golden/rfam/pharokka.gbk b/tests/test_data/golden/rfam/pharokka.gbk new file mode 100644 index 0000000..331267c --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka.gbk @@ -0,0 +1,1792 @@ +LOCUS NC_004617.1 42722 bp DNA linear PHG 02-AUG-2026 +DEFINITION NC_004617.1 Staphylococcus prophage phi 13, complete genome. +ACCESSION NC_004617 +VERSION NC_004617.1 +KEYWORDS . +SOURCE . + ORGANISM . + . +FEATURES Location/Qualifiers + CDS complement(59..1096) + /ID="PHARTEST_CDS_0001" + /transl_table=11 + /phrog="1" + /locus_tag="PHARTEST_CDS_0001" + /function="integration and excision" + /product="integrase" + /score="-1224391000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKTRCYDGKKWQYEFKHEGKRYRKKGFRTKREANSAGLDKLNELR + SGFNIDNYITLAEYFENWIKTYKQPVVKENTYRHYRNALQHIQKHKIGKMELSKINRQV + YQKFINDYSKEHAKETIRKTNGAIRSALDDALYDGLIFKNPAYKVNYKAGKPTKSEQEK + FISVTEYEILKDHVRKKRTRSSLALFIMICTGCRVSGARNIKIEHINQVKNTIFIDERK + TDTSPRYISIAKSDMKHIMDVISTFAISYDGYIFKEAGSIINLQAINNALKSACRVNNI + PIITSHALRHTHCSYLLAKGVSIHYISKRLGHKNIAITTSVYSHLLEEKFNEEDKKTTK + ILESM" + CDS 1087..1188 + /ID="PHARTEST_CDS_0002" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0002" + /function="unknown function" + /product="hypothetical protein" + /score="-0.7254348" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VFSCVPSSKLAKNNKGRRATQNLVLGTKYVIIK" + CDS 1204..1818 + /ID="PHARTEST_CDS_0003" + /transl_table=11 + /phrog="716" + /locus_tag="PHARTEST_CDS_0003" + /function="other" + /product="Na/K ATPase" + /score="-336329.9" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MTQFLGALLLTGVLGYIPYKYLTMIGLVSEKNKIINTPVLLIFSI + ETCLIWFYTFIIFNNVDLKNLSLLQLLTGLKANIWFLIIFVLTVLVFNPLIVKFIIWLI + NETRKFMNLDCISLLDKRDKLFNNNGKPVFIVIKDFENRIIEEGELKTYNSAGSDFDLL + EVERQDFKVSDLPSNDELYIKHTLVDLKQQIKLDLYLMNEY" + CDS complement(1815..1940) + /ID="PHARTEST_CDS_0004" + /transl_table=11 + /phrog="787" + /locus_tag="PHARTEST_CDS_0004" + /function="unknown function" + /product="hypothetical protein" + /score="-6.788884" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MADKNKKQEATRSNPINKSFEKPGASENLKSTLSEKAKKKD" + CDS complement(1997..2164) + /ID="PHARTEST_CDS_0005" + /transl_table=11 + /phrog="1176" + /locus_tag="PHARTEST_CDS_0005" + /function="unknown function" + /product="hypothetical protein" + /score="-3.693734" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LQNKKETIVYEVLTSGNQPFTYELPKDLSSHNARKYLEFISQKLD + GDKLTKEDSL" + CDS complement(2234..2323) + /ID="PHARTEST_CDS_0006" + /transl_table=11 + /phrog="17436" + /locus_tag="PHARTEST_CDS_0006" + /function="unknown function" + /product="hypothetical protein" + /score="-5.398136" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKKAILTLSLIFITYYLTFKYMWIKELKY" + CDS complement(2378..3148) + /ID="PHARTEST_CDS_0007" + /transl_table=11 + /phrog="4" + /locus_tag="PHARTEST_CDS_0007" + /function="transcription regulation" + /product="transcriptional repressor" + /score="-5833512000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MREKVSNRLKHIMKIRNLKQVDIINKSKPYQKKLGISLSKSTLSQ + YINDVQSPDQDRIYLLSKTLNVGEAWLMGYDVDSYRVPDEERQDETIMSKINNIFSQLT + PPRQENVLNYANEQLEEQNKVTSIDGYKESKLVSYIACGATGAGIGEELYDDILHEEVF + FKEDETPSNADFCILVNGDSMEPMLKQGTYAFIKKEDSIKDGTIALVVLDGVSLIKRVD + ICEDYINLVSLNPKYDDIKVASFSDIKVMGKVVL" + CDS 3130..3225 + /ID="PHARTEST_CDS_0008" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0008" + /function="unknown function" + /product="hypothetical protein" + /score="-0.261276" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LKLFLSFSAPPFDNFIIKLVEQKFNKKVHKS" + CDS 3307..3531 + /ID="PHARTEST_CDS_0009" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0009" + /function="unknown function" + /product="hypothetical protein" + /score="-411.6681" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MCYDYSRLSGKIVEKYGTQYNFAIAMKLSERSLSLKLNGKVGWKD + SEIWKAIQLLDIPVEKIHLYFFKEKVHVI" + CDS 3549..3809 + /ID="PHARTEST_CDS_0010" + /transl_table=11 + /phrog="6175" + /locus_tag="PHARTEST_CDS_0010" + /function="unknown function" + /product="hypothetical protein" + /score="-3711.756" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MEQITLTKEECVEQCINKDLKLLDYRVQQILEGVLSESTTYGDAR + NKLETLKIIAESHFKTEHASVIYKLALKKLDEKINATPIKE" + CDS complement(3833..4372) + /ID="PHARTEST_CDS_0011" + /transl_table=11 + /phrog="10240" + /locus_tag="PHARTEST_CDS_0011" + /function="unknown function" + /product="hypothetical protein" + /score="-117442.9" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MDIIAICIAIFSFLLTALKYYLDYMKDSINIDVIPTRSFNYLVDD + KSSYNDITFINFTKFPISVIDVEFDIKNKVNEQKTFKPIRYKDKNYSIPFTLGPYESVE + CTFLLEEYPVIWEWDVTIKVTTNKGIYIKPVIIESRTEHRESEPQVTELTSANKVSALS + NPKDGFLKKFLYHLKP" + CDS 4429..5178 + /ID="PHARTEST_CDS_0012" + /transl_table=11 + /phrog="63" + /locus_tag="PHARTEST_CDS_0012" + /function="transcription regulation" + /product="anti-repressor Ant" + /score="-64592260.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQALKTKSNIGEMFNIQEKENGEIAISARELYKALEVKKRFSAWA + EINLKHFKENRDFTSVLTSTVVNNGAVRQLEDYALTLDVAKHVAMMSGTEKGFDFREYF + IQVEKAWNSPEMIMKRALKIANNTINQLETKIERDKPKIVFADAVATTKTSILVGELAK + IIKQNGINIGQRRLFEWLRQNGFLIKRKGVDYNMPTQYSMERELFEIKETSITHSDGHT + SISKTPKVTGKGQQYFVNKFLGEKQTS" + CDS 5194..5391 + /ID="PHARTEST_CDS_0013" + /transl_table=11 + /phrog="845" + /locus_tag="PHARTEST_CDS_0013" + /function="unknown function" + /product="hypothetical protein" + /score="-562.1181" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQAQNKKVIYYYYDEAGNRRPVNIQYNDGYDLMIDPRFIEMTLER + HPHLKNNFYGLIDGKEFKLD" + CDS 5422..5562 + /ID="PHARTEST_CDS_0014" + /transl_table=11 + /phrog="1263" + /locus_tag="PHARTEST_CDS_0014" + /function="unknown function" + /product="hypothetical protein" + /score="-226.453" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLQKFRIAKEKNKLKLKLLKHASYCLERSNNPELLRAVAELLKKV + N" + CDS complement(5577..6209) + /ID="PHARTEST_CDS_0015" + /transl_table=11 + /phrog="4768" + /locus_tag="PHARTEST_CDS_0015" + /function="unknown function" + /product="hypothetical protein" + /score="-369622.9" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VYIDPLKNVRFSINNVISNVEISKSMAIKQSLKPKYQLDIINRNN + INLFSDFKVDFHLNNLIEMNFNLRNSFSSLTFQRNLFSEETIKSFKELYRFDDEIVLQA + QQTIRDFYINPTAISTLAEAINSTYPINEQSTYKRHDEFVKRIENDFPHPFKKLIRWSN + GIAAGADIQIFVTNYINENDLHIQNSLIVAIVCLLSFLSTYCSHSKK" + CDS 6268..6588 + /ID="PHARTEST_CDS_0016" + /transl_table=11 + /phrog="823" + /locus_tag="PHARTEST_CDS_0016" + /function="unknown function" + /product="hypothetical protein" + /score="-819.0921" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MPHILNVTVPIPETHVLITKDEYDELIGYSLDPVWNMSDLKKKLK + IASDETIKDRLLFHPRFEKELRAQGIVHYPDENFNRWRFNARKMNKFVDEHFNEIYKER + IK" + CDS 6585..6746 + /ID="PHARTEST_CDS_0017" + /transl_table=11 + /phrog="369" + /locus_tag="PHARTEST_CDS_0017" + /function="unknown function" + /product="hypothetical protein" + /score="-14.63112" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MSNIYKSYLVAVLCFTVLAIVLMPFLYFTTAWSIAGFASIATFIF + YKEYFYEE" + CDS 6839..7099 + /ID="PHARTEST_CDS_0018" + /transl_table=11 + /phrog="401" + /locus_tag="PHARTEST_CDS_0018" + /function="unknown function" + /product="hypothetical protein" + /score="-247.9693" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MYYKIGDVCQKVINVDGFDFKLAVKKQDYSILVNVLDLEDRFIDG + INITDENDLYTALDILNQSIYEWIEENTDERDRLINLVMRW" + CDS 7109..7330 + /ID="PHARTEST_CDS_0019" + /transl_table=11 + /phrog="946" + /locus_tag="PHARTEST_CDS_0019" + /function="unknown function" + /product="hypothetical protein" + /score="-413.1051" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKQTVTYLIKHKDENLFITNRPTEVNDTVKYSTDMRDAREFDGLD + KTVIDMSKHKAIKKTVTETIEYEKVEHD" + CDS 7323..8102 + /ID="PHARTEST_CDS_0020" + /transl_table=11 + /phrog="124" + /locus_tag="PHARTEST_CDS_0020" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="Sak4-like ssDNA annealing protein" + /score="-990899.9" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MTEKTNQDVDILTQLGVKDISKQNANKFYKFAIYGKFGTGKTTFL + TKDNNALVLDINEDGTTVTEDGAVVQIKNYKHFSAVIKMLPKIIEQLRENGKQIDVVVI + ETIQKLRDITMDDIMDGKLKKPTFNDWGECATRIVSIYRYISKLQEHYQFHLAISGHEG + INKDKDDEGSTINPTITIEAQDQIKKAVISQSDVLARMTIEEHEQDGEKAYQYVLNAEP + SNLFETKIRHSSNIKINNKRFINPSINDVVQAIRNGN" + CDS 8133..8684 + /ID="PHARTEST_CDS_0021" + /transl_table=11 + /phrog="378" + /locus_tag="PHARTEST_CDS_0021" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="single strand DNA binding protein" + /score="-1198907.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKITGQAQFTKETNQEKFYNGSAGFQAGEFTVKVKNIEFNDRENR + YFTIVFENDEGKQYKHNQFVPPYKYDFQEKQLIELVTRLGIKLNLPSLDFDTNDLIGKF + CHLVLKWKFNEDEGKYFTDFSFIKPYKKGDDVVNKPIPKTDKQKAEENNGAQQQTSMSQ + QSNPFESSGQFGYDDQDLAF" + CDS 8697..9368 + /ID="PHARTEST_CDS_0022" + /transl_table=11 + /phrog="398" + /locus_tag="PHARTEST_CDS_0022" + /function="unknown function" + /product="hypothetical protein" + /score="-302118.5" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQYITRYQKDNDGTYSVVATGVELEQSHIDLLENGYPLKAEVEVP + DNKKLSIEQRKKIFAMCRDIELHWGEPVESIRKLLQTELEIMKGYEEISLRDCSMKVAR + ELIELIIAFMFHHQIPMSIETSKLLSEDKALLYWATINRNCVICGKPHADLAHYEAVGR + GMNRNKMNHYNKHVLALCREHHNQQHAIGVKSFDDKYHLHDSWIKVDERLNKMLKGEKK + E" + CDS 9365..9514 + /ID="PHARTEST_CDS_0023" + /transl_table=11 + /phrog="1902" + /locus_tag="PHARTEST_CDS_0023" + /function="unknown function" + /product="hypothetical protein" + /score="-207.6077" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MNRLRIIKIALLIVILAEEIRSAKKIKKFTPEDSKGFPDITKDSI + KEPK" + CDS complement(9507..9788) + /ID="PHARTEST_CDS_0024" + /transl_table=11 + /phrog="1090" + /locus_tag="PHARTEST_CDS_0024" + /function="unknown function" + /product="hypothetical protein" + /score="-376.2408" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MEKPYMLTYDLNSPGQKYEELRNVIKKEISNGHCNYWKSSFLFRS + SLSTSEMIEKLKPYLDSGDKLFVTEIVNNKQGWLTKEQWDFINHNIFI" + CDS 9764..10624 + /ID="PHARTEST_CDS_0025" + /transl_table=11 + /phrog="428" + /locus_tag="PHARTEST_CDS_0025" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="replication initiation protein" + /score="-26027360.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLTYKVFPYFIHPQSNAVAITKLYQKGDNEMATFRVYKESGNFVT + VHKDFIHDSNISWKAKGILLYLLSRPDNWQIYETELEQHSTDGLSGLKSGIKELEEIGY + IQRSRKRDKSGRLNGYEYLVYEQPHHIRFSNVGKTVNGKTNNGKTVNGKSHTTNNNSTN + NDLTNNNNTNNEGSILSGNPTVSSIPYKEIIEYLNKKAGKHFKHNTAKTKDFIKARWNQ + DFRLEDFKKVIDIKTAEWLNTDSDKYLRPETLFGSKFEGYLNQKIQPTGTDQLERMKYD + ESYWD" + CDS 10634..11413 + /ID="PHARTEST_CDS_0026" + /transl_table=11 + /phrog="50" + /locus_tag="PHARTEST_CDS_0026" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="DnaC-like helicase loader" + /score="-876131.3" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKPLFSEKINESLKKYQPTHVEKGLKCERCGSEYDLYKFAPTKKH + PNGYEYKDGCKCEIYEEYKRNKQRKINNIFNQSNVNPSLRDATVKNYKPQNEKQVHAKQ + TAIEYVQGFSTKEPKSLILQGSYGTGKSHLAYAIAKAVKAKGHTVAFMHIPMLMDRIKA + TYNKNAVETTDELVRLLSDIDLLVLDDMGVENTEHTLNKLFSIVDNRVGKNNIFTTNFS + DKELNQNMNWQRINSRMKHNARKVRVIGDDFRERDAW" + CDS 11407..11565 + /ID="PHARTEST_CDS_0027" + /transl_table=11 + /phrog="809" + /locus_tag="PHARTEST_CDS_0027" + /function="transcription regulation" + /product="transcriptional regulator" + /score="-17.82607" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MVTKEFLKIKLECSDMYAQKLIDEAQGDENKLYDLFIQKLAERHT + RPAVVEY" + CDS 11578..11799 + /ID="PHARTEST_CDS_0028" + /transl_table=11 + /phrog="433" + /locus_tag="PHARTEST_CDS_0028" + /function="unknown function" + /product="hypothetical protein" + /score="-142.4595" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MPKEKYYLYREDGTEDIKVIKYKDNVNEVYSLTGAHFSDEKKIMT + DRDLKRFKGAHGLLYEQELGLQATIFDI" + CDS 11810..12214 + /ID="PHARTEST_CDS_0029" + /transl_table=11 + /phrog="190" + /locus_tag="PHARTEST_CDS_0029" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="Holliday junction resolvase" + /score="-576.0835" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MSKYNAKKVEYKGIVFDSKVECEYYQYLESNMNGTNYDRIELQPK + FELQPKFGKQRPITYIADFSLWKEGKLVEVIDVKGKATEVANIKAKIFRYQYRDVNLTW + ICKAPKYTGQEWMVYEDLVKVRRKRKREMK" + CDS 12219..12404 + /ID="PHARTEST_CDS_0030" + /transl_table=11 + /phrog="299" + /locus_tag="PHARTEST_CDS_0030" + /function="unknown function" + /product="hypothetical protein" + /score="-67.00934" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQQQAYINATIDIRIPTEVEYHHFDDVDDEKDMLAKRLDDNPDEL + LKYDNITIRHAYIEVE" + CDS 12405..12776 + /ID="PHARTEST_CDS_0031" + /transl_table=11 + /phrog="201" + /locus_tag="PHARTEST_CDS_0031" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="Panton-Valentine leukocicin" + /score="-4011.613" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAKAARIVRIHDKPYRFSKFEMELIESHGITAGMVSKRVKDGWEL + HEAMDAPEGTRLSEYREKKTIERLEQARLERKLERKRKREAELRRKKPHLFNVPQKHSR + DPYWFDNTYNQMFKKWQEV" + CDS 12777..13025 + /ID="PHARTEST_CDS_0032" + /transl_table=11 + /phrog="258" + /locus_tag="PHARTEST_CDS_0032" + /function="other" + /product="virulence associated" + /score="-46.32995" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MPKTDSACKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHI + VPGWQGVKKTFDTTEELETYIKQHGLEYEEQKQLTLF" + CDS 13089..13436 + /ID="PHARTEST_CDS_0033" + /transl_table=11 + /phrog="24347" + /locus_tag="PHARTEST_CDS_0033" + /function="unknown function" + /product="hypothetical protein" + /score="-70910.01" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MMPKFRAWDKDKKVMSFIDEIDFNSGYILISTGYKSFNEVKLLQY + TGFKDVHGVEIYEGDIVQDSYSGEVSFIEFKEGAFYITFSNVTELISENDDIIEIIGNI + FENEELLEVMR" + CDS 13433..13822 + /ID="PHARTEST_CDS_0034" + /transl_table=11 + /phrog="742" + /locus_tag="PHARTEST_CDS_0034" + /function="other" + /product="acetyltransferase" + /score="-22939.32" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MTVTLSDEQYKNLCTKLNKLLGKFHKALKERDEYKKQQDELIVDI + GKLRERNKELENMWRTLKNELLGRYEHYCFKFRELHPESKANRIGALYIGGKSTADIIM + SRMEELDGTNEFYEFLGQMEEDTNE" + CDS 13815..14069 + /ID="PHARTEST_CDS_0035" + /transl_table=11 + /phrog="4380" + /locus_tag="PHARTEST_CDS_0035" + /function="unknown function" + /product="hypothetical protein" + /score="-1762.447" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEG + MTNAIQHSVKEGIELDEAIGIMVSQVIYEYKEELENEKI" + CDS 14056..14226 + /ID="PHARTEST_CDS_0036" + /transl_table=11 + /phrog="1235" + /locus_tag="PHARTEST_CDS_0036" + /function="unknown function" + /product="hypothetical protein" + /score="-600.1063" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKKFNVQITYTGMIEEAIEAESLEEAEFEAHDIARMEVPFDCDEF + EINVEVEQENE" + CDS 14219..14755 + /ID="PHARTEST_CDS_0037" + /transl_table=11 + /phrog="173" + /locus_tag="PHARTEST_CDS_0037" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="nucleoside triphosphate pyrophosphohydrolase" + /score="-33454.96" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MNNTLTIDQLQELLQIQKEFDDRIPTLNLRDSKIAYVVEFFEWFN + TLETFKNWKKKPGKPLDVQLDELADMLAFGLSIANQVGVSSEEIKEAIESSFKNTEFHK + MFNFKDKEFAQDAVVSTPQIIFKEFYPDQLAIVIVIDIAYNLYSIDQLIDAYKKKMKRN + HERQDGTADAGKGYV" + CDS 14792..14965 + /ID="PHARTEST_CDS_0038" + /transl_table=11 + /phrog="3521" + /locus_tag="PHARTEST_CDS_0038" + /function="unknown function" + /product="hypothetical protein" + /score="-75.45788" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VRERTKIIYRGWNKEIFILQGKNMNVIGLRQIFDELKRLYEGYKI + VVIPIEVDFEIK" + CDS 14982..15188 + /ID="PHARTEST_CDS_0039" + /transl_table=11 + /phrog="278" + /locus_tag="PHARTEST_CDS_0039" + /function="transcription regulation" + /product="transcriptional regulator" + /score="-54.02398" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VTQYLVTTFKDSSGLPHEHFTAARDNQTFTVVEAESKEEAKEKYE + AQVKRDAVIKLGQLFENIRECGK" + CDS 15185..15334 + /ID="PHARTEST_CDS_0040" + /transl_table=11 + /phrog="152" + /locus_tag="PHARTEST_CDS_0040" + /function="transcription regulation" + /product="RinB-like transcriptional activator" + /score="-33.26004" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYVFRA + EVSE" + CDS 15334..15534 + /ID="PHARTEST_CDS_0041" + /transl_table=11 + /phrog="386" + /locus_tag="PHARTEST_CDS_0041" + /function="unknown function" + /product="hypothetical protein" + /score="-338.2886" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MWITMTIVFAILLLVCISINSDRAREIQALRYMNDYLLDEVVKTK + GYNGLEEYRIELKRINNDIKK" + CDS 15557..16027 + /ID="PHARTEST_CDS_0042" + /transl_table=11 + /phrog="1058" + /locus_tag="PHARTEST_CDS_0042" + /function="unknown function" + /product="hypothetical protein" + /score="-443.2011" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MYNRKEIREMIDNYKWMKNIIDSKVYDNESTSIAQYGYQSAMPKA + KGTTSNKVLVKVINKNKALRKYDYLIKKIAFIDEYEEYITNEKDYHILQMLKQRESHNR + IMSILDIGRDNFYSRVKDIVNILYNLQQETDSSDTSYSSDTSYSSDTSYSSD" + CDS 16142..16594 + /ID="PHARTEST_CDS_0043" + /transl_table=11 + /phrog="229" + /locus_tag="PHARTEST_CDS_0043" + /function="other" + /product="MazG-like pyrophosphatase" + /score="-32234.19" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MEISKYQEIATRTHNDELNLNEYITCYGLGLTQSTGNVTDLIKQH + MFCNVPIDKGIMINELSEALWNIANLTNVLGINLDEIAGHSVNTILMNKPNQTINLDNG + IKRGDKVLFQGSKYLVDGSIGNLLLISNDKDDRQVTVQDVKKVDKE" + CDS 16610..16954 + /ID="PHARTEST_CDS_0044" + /transl_table=11 + /phrog="144" + /locus_tag="PHARTEST_CDS_0044" + /function="DNA" + /function=" RNA and nucleotide metabolism" + /product="HNH endonuclease" + /score="-5902.167" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKRCGHPTCNVLINHNESYCDKHKQYANENYNDLRRRNDPEYLRF + YKSKTWQNMRRIVLLEHDFICVSCGNQATMVDHIVPTKIDWARRLDKSNLQPLCDACHN + QKTKEDLKKY" + CDS 16985..17080 + /ID="PHARTEST_CDS_0045" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0045" + /function="unknown function" + /product="hypothetical protein" + /score="-1.419676" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKRASMKGSGERSRVFFSKNSLYLSFFSRRC" + CDS 17084..17551 + /ID="PHARTEST_CDS_0046" + /transl_table=11 + /phrog="83" + /locus_tag="PHARTEST_CDS_0046" + /function="head and packaging" + /product="terminase small subunit" + /score="-401471.4" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAGRPKKLLSNSNKNYTKEEIIEKERQEAQLNKFSKIDTEPPHFL + DEIAKQEYLRILPHMQELPISNLDKAQLAQYCSFYSDFVKASLILEREDLILEDDKGNQ + KVNPAFNIKEKAGIRLQQTANTLGLTIDSRLRIMVPDEKEDDDPYMEFVSD" + CDS 17554..19248 + /ID="PHARTEST_CDS_0047" + /transl_table=11 + /phrog="9" + /locus_tag="PHARTEST_CDS_0047" + /function="head and packaging" + /product="terminase large subunit" + /score="-1.423703e+16" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MTDYVTKYAKKVVSGEILASLKNIQVCKRHLSFMENPPNGCHWDN + HLSNKAIKFVEMLPDPKTNQPMPLMEFQKFIVGSLYGWRRGQYRMFTKAYISMARKQGK + SLIVSGMSVNELLFGQYPKFNRQIYVASSTYKQAQTIFKMASQQVNLMRSKSKFIREKT + DVRKTDIEDVLSSSVFAPLSNNPDAVDGKDPTVAILDELASMPDDEMYSRFKTGMTLQK + NPLTLLVSTAGDNLNSQMYQEYKYIKRILNEEVRADNYFVYCAEMDSQEEVQDETKWIK + AMPLLESKEHRKTILQNVKADIQDELEKGTSYHKILIKNFNLWQAQREDSLLDISDWEQ + VITPMPNINGKDVYIGVDLSRLDDLTSVGFIFPNDDKKVFLHSHSFIGLRTNLEQKSKR + DKINYELAIERGEAETTQSDSGMIDYKQVIDFIVKFITTHDLNVQAVCYDPWNAQSFIT + TIESMALDWPLIEVGQSFKALSQSIKEFRMWVADERIQHNDNMLLTTSVNNAVLIRDGE + DNVKINKKMNRQKIDPIISIITAFTEARMHEFQENWTEKYESEEFGF" + CDS 19393..20718 + /ID="PHARTEST_CDS_0048" + /transl_table=11 + /phrog="12" + /locus_tag="PHARTEST_CDS_0048" + /function="head and packaging" + /product="portal protein" + /score="-3526820000000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MHWYNTDCYFVDFKSRKQSRKELVVVGIFYKNEKRDLQYNEDDLQ + MMVQTLPGFQGTKLRQYKDIEAIRHSDIFTAVMMIASDLARMPIRVTVNGQINYSDRIV + NLLNTRPNPMYNGYIFKLVVFVSALLTSHGYIEITRDKTGEPMNLTFRKTSEIELKSDA + RGRLYYFHQRIDSNGNNIERNVKFEDMLDIKFYSLDGINGLSLLDTLSRTIESDNNGKD + FLNNFLRNGTHAGGILKMKGVLDNKKARDRAREEFHKSFSGTKQAGKVVVLDESMTFDQ + LEVDTEVLKLIRENKSSTREIAGVFGIPLHKFGIETANMSITDANLDYLSTLKPYITCV + CAELNFKFNDEYVNREFKFDTTEIRVVDEKTQAEIDKINIDSGKMNIDEIRQRDGLAPI + PGGNGSIHRVDLNHVNIELVDEYQMNKSRATDKKLKGGEENE" + CDS 20711..21295 + /ID="PHARTEST_CDS_0049" + /transl_table=11 + /phrog="9644" + /locus_tag="PHARTEST_CDS_0049" + /function="head and packaging" + /product="head maturation protease" + /score="-718699.2" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MSKETRVGNIIEVRSNDNNEMVIEGYALKFDTWSENLGGFKETIS + RRALENTDLSDVRCLVDHIPSQIIGRTKSGTLELETDDVGLKYRCKLPNTTFARDLYEN + MRVGNINQCSFGFMLDDKGDEVRFDEQENIYKRTLTAIRELTDVSVVTYPAYKDTDVKP + ALRSIETVKKEQRKKELEIRLKKHSILNNIW" + CDS 21383..22630 + /ID="PHARTEST_CDS_0050" + /transl_table=11 + /phrog="10" + /locus_tag="PHARTEST_CDS_0050" + /function="head and packaging" + /product="major head protein" + /score="-1037907000000000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKTKEELQSEISDIKRQIDLKVKYATRALNNDELEKAEKLEQEIT + DLRSQIQEKQEELDKLKEKDGTSENNQQSVEVNEASTYRNQANINDLGISIQNTKVTSQ + EVRDFTEYLETRNDIQGGSLKTDSGFVVIPEEIVTDILKLKEVEFNLDKYVTVKRVTNG + SGKYPVVRQSEVAALEKVEELEENPELAVKPFFQLAYDINTHRGYFRISREAIEDAKVN + VLQELKLWMARTIAATRNKAIIDVITKGSTGSTSSGFEKEGKKLEVKKAKSLDDIKDAI + NLNVKPNYEHNVAIVSQTMFAKLDKMKDKLGNYLIQPDVKEKTQQRLLGAKIEILPDEV + LGQKGNNTLIIGNLKDAIVLFDRSQYQASWTDYMHFGECLMIAVRQDCRILDYKSAIVI + EYDDSERGEGDLGLEA" + CDS 22666..22824 + /ID="PHARTEST_CDS_0051" + /transl_table=11 + /phrog="933" + /locus_tag="PHARTEST_CDS_0051" + /function="unknown function" + /product="hypothetical protein" + /score="-35.50524" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAMYEVKKSYTDLEKGQYLKSGKRVEMTVKRAEYVNKKLKEHGVI + LERVKEE" + CDS 22833..23165 + /ID="PHARTEST_CDS_0052" + /transl_table=11 + /phrog="40" + /locus_tag="PHARTEST_CDS_0052" + /function="connector" + /product="head-tail adaptor Ad1" + /score="-1015.769" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQLTAEELKLLKKHCKIDHNSEDDLLEIYYSWAFREIASAVTDKP + SKYIDWFKSHPLFARAIYPLASYYFENRIAYLDRDLSLAPHMVLSTVHKLRGSFEQFLE + SENDEI" + CDS 23152..23487 + /ID="PHARTEST_CDS_0053" + /transl_table=11 + /phrog="25" + /locus_tag="PHARTEST_CDS_0053" + /function="connector" + /product="head closure Hc1" + /score="-125.4829" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MMKFNSNKLNERIDFCEDVSERVNGNPMKPKTKILYSCFACIQES + KESDTQTNLNTGSKFIKTIIIRDTRGDYKPTNKHYVLHEGQRFNIKYVKPDYQDKSYLR + IYGEVVI" + CDS 23487..23864 + /ID="PHARTEST_CDS_0054" + /transl_table=11 + /phrog="5" + /locus_tag="PHARTEST_CDS_0054" + /function="connector" + /product="tail completion or Neck1 protein" + /score="-45675.83" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MGARIESNNIEQGLKNAVLKMNLNSNVIVKAGAMSLVPLLKSNTP + FANTKKHARDHIAVSNVKTDRHTSEKIVTIGYAKGVSHRIHATEFGTMYQKPQLFITKT + EKQGKNKVLKTMLDTAKRLQK" + CDS 23861..24241 + /ID="PHARTEST_CDS_0055" + /transl_table=11 + /phrog="78" + /locus_tag="PHARTEST_CDS_0055" + /function="connector" + /product="tail terminator" + /score="-621.686" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MINVTKLIRNAIIANNITDEVNVFNYTIDDHFHEKTDKPIIRIYP + LPFNPDTYADDNEISREYHYQIDVWWSQDEPNEQAEKIVELLKVINFQCYYREPLYESD + VMSFRHIIRAKGSILSMKLEEN" + CDS 24242..25195 + /ID="PHARTEST_CDS_0056" + /transl_table=11 + /phrog="88" + /locus_tag="PHARTEST_CDS_0056" + /function="tail" + /product="major tail protein" + /score="-68775320000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MIEKLKQAPRFLKLNLQHFADTGVSGIAIGVSNFYYAPILKDTEN + EWETGAGTRIRFLKEIEVDRPQDTEEDYGDDMVAATAVSNGKLSVKTTFVTVPADDKAF + LNGAKKGVGGYKYGAKDIPPDVAIVFERRNHDESSEWVGLFKGKFTRSSIKGQTKQDKV + EFQNDDVEGNFIDRLFDESSHVTGYDKKGSTTGRDYVFMETFGKTYDEFMSSRGEQNME + PVEKEMKKTEKVEVTSVNVTDEQVTVKVDATKQLSATTEPSGQKVTYAVTEGQTYASVT + STGLVKGLAEGNATVTATAGKQTDTVQITVQSNLEM" + CDS 25260..25706 + /ID="PHARTEST_CDS_0057" + /transl_table=11 + /phrog="187" + /locus_tag="PHARTEST_CDS_0057" + /function="connector" + /product="head-tail adaptor" + /score="-45214.34" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MERTSIELITGFTKTGKPQYQKYLAKPIITLFETIQGSKLGLKLN + KAFKGADFKDLTEEEFNNLSVTEQEEYKNKQEEYENNMAVQMEVLEEVLDFIVEAFDNQ + FTSIELQKGLPNGQEGIEKIGQLIGRITGGEPSDTKKFVTENQK" + CDS 25781..25888 + /ID="PHARTEST_CDS_0058" + /transl_table=11 + /phrog="15504" + /locus_tag="PHARTEST_CDS_0058" + /function="unknown function" + /product="hypothetical protein" + /score="-2.584621" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MDAEKVANMPIHFFLDIVESKIETKRTAKSFKDIF" + CDS 25944..30596 + /ID="PHARTEST_CDS_0059" + /transl_table=11 + /phrog="4070" + /locus_tag="PHARTEST_CDS_0059" + /function="tail" + /product="tail length tape measure protein" + /score="-1.857625e+36" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MPNPIGNMVIKVDLDGSGFNRGVTGLNRQMKMVSRELSANLSQFS + RYDNSLEKSKIKVEGLSKKQKVQAQITKELKDSYDKLSKETGENSAKTQAAAAKYNEAY + AKLNQYERELNQATQELKDMQREQKALNTAMGKLGTNFNNFGPKLQEIGNSMKNVGRNM + TMYVTAPVVAGFAVAAKKGIEFDDSMRKVKATSGATGEEFEALKKKAREMGATTKFSAS + DSAEALNYMALAGWDSKQMMEGLSGVMDLAAASGEELEAVSDIVTDGLTAFGLKAKDSG + HFADILAQTSSKANTDVRGLGEAFKYVAPVAGALGYTIEDTSIAIGLMSNAGIKGEKAG + TALRTMFTNLSSPTRAMGNEMERLGISITDSNGKMIPMRKLLDQLREKFKHLSKDQQAS + SAATIFGKEAMSGALAIINASDEDYQKLTKSIDSSTGASKRMADTMESGLGGKLRTLRS + QLEELALTIYDRIEPALKIIVSAFSKVVTWVTKLPTSIQLAVVGFGLFAAVLGPLVFMF + GLFISVMGNAMTVLGPLLINVNKAGGLFAFLRTKIASLVKLFPILGVSISSLTLPITLI + VGALVGIGIAFYQAYKRSETFRNIVNQAISGVANAFKAAKLALQGFFDLFKGDSKGAVT + LEKIFPPETVAGIQNVVNTIRTTFFKVVDAIVGFAKEIGAQLASFWKENGSEITQALQN + IAGFIKATFEFIFNFIIKPIMFAIWQVMQFIWPAVKALIVSTWENIKGVIQGAINIILG + IIKVFSSLFTGNWRGVWDGIVMILKGTVQLIWNLIQLWFVGKILGVVRYFGGLLKGLIS + GIWGVIKGIFTKSLSAIWNATKSIFGFLYNSVKSIFTNMKNWLSSTWNNIKSNTVGKAH + SLFTGVRSKFTSLWNATKDIFTKLRNWMSNIWNSIKDNTVGIAGRLWDKVRNIFGNMRD + GLKSIIGKIKDHIGGMVDAIKKGLNKLIEGLNWVGGKLGMDEIPRLHTGTEHTHTTTRL + VKNGKIARDTFATVGDKGRGNGPNGFRNEMIEFPNGKRVITPSTDTTAYLPKGSKVYNG + AQTYSMLNGTLPRFHFGTTMWKDIKSSASSAFNWTKDQIGKGTKWLGDKVGDVMDFIDN + PGKLLNYVLQAFGVDFSSLTKGMGIAGDITKAAWSKIKKSAIKWLEDAFAESGDGGVLD + MSKLRYLYGHTAAYTRETGRPFHEGLDFDYIYEPVPSTINGRAQVMPVHNGGYGKWVKI + VKGALEVIYAHLSKYKVKTGQQVRVGQTVGISGNTGFSTGPHLHYEMRWNGRHRDPLPW + LRKNNGGGKSTPGGNGAANARRAIKAAQNILGGRYKASWITNEMMRVASRESNYTANAV + NNWDSNARAGIPSRGMFQMIDPSFRAYAKSGYNNPLNPTHQAISAMRYIVGKWVPRTGS + WRAAFKRAGDYAYATGGKVYNGLYHLGEEGYPEWIIPTDPSRANEAHKLLALAANDIDN + RSKNKRPNNLPNPSISNSDTNYIHTLENKLDAVINCLVSLVESNQVIADKDYEPVINKY + VFEDEVNNSIDKRERHESTRVRFRRGGTII" + CDS 30596..32086 + /ID="PHARTEST_CDS_0060" + /transl_table=11 + /phrog="202" + /locus_tag="PHARTEST_CDS_0060" + /function="tail" + /product="distal tail protein Dit" + /score="-27602240000000.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQDTIQIDNKTIGWLVVQRGFEIPSFNFVTEKENVKGRAGSIVKN + RYLNDIEFDLPLIIRNEKLSPGGEKTHDDILEALVKFFNIKDLTPKKLKFKSQNWYWFA + YFDGPLKLPKNPRGSVKFTIKVVLTDPYKYSVTGNKNTAISDQVSVVNSGTADTPLIVE + ARAIKPSSYFMITKNDEDYFMVGDDEVTKEVKDYMPPVYHSEFRDFKGWTKMITEDIPS + NDLGGKVGGDFVISNLGEGYKATNFPDAKGWVGAGTKRGLPKAMTDFQITYKCIVEQKG + KGAGRTAQHIYDSDGKLLASIGYENKYHDRKIGHIVVTLYNQKGDPKKIYDYQNKPIMY + NLDRIVVYMRLRRVGNKFSIKTWKFDHIKDPDRRKPIDMDEKEWIDGGKFYQRPASIIA + IYSAKYNGYKWMEMNGLGSFNTEILPKPKGARDVIIQKGDLVKIDMQAKSVVINEEPML + SEKSFGSNYFNVDSGYSELIIQPENVFDTTVKWQDRYL" + CDS 32102..35887 + /ID="PHARTEST_CDS_0061" + /transl_table=11 + /phrog="1786" + /locus_tag="PHARTEST_CDS_0061" + /function="head and packaging" + /product="minor head protein" + /score="-1.286733e+36" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VIHVLDFNDKIIDFLSTDDPSLVRAIHKRNVNDNSEMLELLISSE + RAEKFRERHRVIIRDSNKQWREFIINWVQDTMDGYTEIECIASYLADITTAKPYAPGKF + EKKTTSEALKDVLSDTGWEVSEQTEYDGLRTTSWTSYQTRYEVLKQLCTTYKMALDFYI + ELSSNTVKGRYVVLKKKNSLFKGKEIEYGKDLVGLTRKIDMSEIKTALIAVGPENDKGK + RLELVVTDDEAQSQFNLPTRYIWGIYEPQSDDQNMNETRLRSLAKTELNKRKSAVMSYE + ITSTDLEVTYPHEIISIGDTVRVKHRDFNPPLYVEAEVIAEEYNIISENSTYTFGQPKE + FKESELREEFNKRLNIIHQKLNDNISNINTIVKDVVDGELEYFERKIHKNDTPPENPVN + DMLWYDTSNPDVAVLRRYWNGRWIEATPNDVEKLGGITREKALFSELNNIFINLSIQHA + SLLSEATELLNSEYLVDNDLKADLQASLDAVIDVYNQIKNNLESMTPETATIGRLVDTQ + ALFLEYRKKLQDVYTDVEDVKIAISDRFKLLQSQYTDEKYKEALEIIATKFGLTVNEDL + QLVGEPNVVKSAIEAARESTKEQLRDYVKTSDYKTDKDGIVERLDTAEAERTTLKGEIK + DKVTLNEYRNGLEEQKQYTDDQLSDLSNNPEIKASIEQANQEAQEALKSYIDAQDNLKE + KESQAYADGKISEEEQRAIQDAQAKLEEAKQNAELKARNAEKKANAYTDNKVKESTDAQ + RRTLTRYGSQIIQNGKEIKLRTTKEEFNATNRTLSNILNEIVQNVTDGTTIRYDDNGVA + QALNVGPRGIRLNADKIDINGNREINLLIQNMRDKVDKTDIVNSLNLSREGLDINVNRI + GIKGGNNNRYVQIQNDSIELGGIVQRTWKGKRSTDDIFTRLKDGHLRFRNNTAGGSLYM + SHFGISTYIDGEGEDGGSSGTIQWWDKTYSDSGMNGITINSYGGVVALTSDNNRVVLES + YASSNIKSKQAPVYLYPNTDKVPGLNRFAFTLSNADNAYSSDGYIMFGSDENYDYGAGI + RFSKERNKGLVQIVNGRYATGGDTTIEAGYGKFNMLKRRDGNRYIHIQSTDLLSVGSDD + AGDRIASNSIYRRTYSAAANLHITSAGTIGRSTSARKYKLSIENQYNDRDEQLEHSKAI + LNLPIRTWFDKAESEILARELREDRKLSEDTYKLDRYVGLIAEEVENLGLKEFVTYDDK + GEIEGIAYDRLWIHLIPVIKEQQLRIKKLEESKNAG" + CDS 35877..36029 + /ID="PHARTEST_CDS_0062" + /transl_table=11 + /phrog="1399" + /locus_tag="PHARTEST_CDS_0062" + /function="unknown function" + /product="hypothetical protein" + /score="-401.7119" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MQDNKQGLQANPEYTIHYLSQEIMRLTQENAMLKAYIQENKENQQ + CAEEE" + CDS 36076..36363 + /ID="PHARTEST_CDS_0063" + /transl_table=11 + /phrog="1747" + /locus_tag="PHARTEST_CDS_0063" + /function="unknown function" + /product="hypothetical protein" + /score="-35927.44" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAKEIINNTERFILVQIDKEGTERVVYQDFTGSFTTSEMVNHAQD + FKSEENAKKIAETLNLLYQLTNKKQRVKVVKEVVERSDLSPEVTVNTETV" + CDS 36487..36717 + /ID="PHARTEST_CDS_0064" + /transl_table=11 + /phrog="276" + /locus_tag="PHARTEST_CDS_0064" + /function="unknown function" + /product="hypothetical protein" + /score="-87.5808" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEKNKKENDK + NIRDMKMWVLGLVGTIFGSLIIALLRMLMGI" + CDS complement(36824..37033) + /ID="PHARTEST_CDS_0065" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0065" + /function="unknown function" + /product="hypothetical protein" + /score="-0.06822175" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LLNSISLITRPINAIRNKPNCNMVLIVIIRRLLSKDFSNATIGTT + SLYSDSHHLSNLLTSAYYHNYNNK" + ncRNA 36836..37015 + /ID="PHARTEST_ncRNA_1" + /locus_tag="PHARTEST_ncRNA_1" + /product="Listeria sRNA rli28" + /Dbxref="RFAM:RF01492" + /ncRNA_class="ncRNA" + /note="rli28" + /score="94.6" + /inference="profile:Infernal:1.1.5" + CDS complement(37096..37203) + /ID="PHARTEST_CDS_0066" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0066" + /function="unknown function" + /product="hypothetical protein" + /score="-0.5872936" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LIFILWCVNLYIEKGQHAQTCYPNEPVKKTVAILD" + CDS 37255..37509 + /ID="PHARTEST_CDS_0067" + /transl_table=11 + /phrog="297" + /locus_tag="PHARTEST_CDS_0067" + /function="lysis" + /product="holin" + /score="-1784.258" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTD + GLNAILGFLVLTGVIQDPTTKGIGDSHQALEYEEPRRKY" + CDS 37521..38276 + /ID="PHARTEST_CDS_0068" + /transl_table=11 + /phrog="635" + /locus_tag="PHARTEST_CDS_0068" + /function="lysis" + /product="endolysin" + /score="-2998422.0" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKTYSEARARLRWYQGRYIDFDGWYGYQCADLAVDYIYWLLEIRM + WGNAKDAINNDFKNMATVYENTPSFVPQIGDVAVFTKGIYKQYGHIGLVFNGGNTNQFL + ILEQNYDGNANTPAKLRWDNYYGCTHFIRPKYKSEGLMNKITNKVKPPAQKAVGKSASK + ITVGSKAPYNLKWSKGAYFNAKIDGLGATSATRYGDNRTNYRFDVGQAVYAPGTLIYVF + EIIDGWCRIYWNNHNEWIWHERLIVKEVF" + CDS 38467..38958 + /ID="PHARTEST_CDS_0069" + /transl_table=11 + /phrog="4358" + /locus_tag="PHARTEST_CDS_0069" + /function="other" + /product="kinase" + /score="-325788.2" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYF + EPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFR + VVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVIIEKK + " + CDS 39003..39104 + /ID="PHARTEST_CDS_0070" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0070" + /function="unknown function" + /product="hypothetical protein" + /score="-1.780166" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MCSENYLSSNSHSCTNGSSPPNQILGDLWGEIS" + CDS 39114..39248 + /ID="PHARTEST_CDS_0071" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0071" + /function="unknown function" + /product="hypothetical protein" + /score="-0.6784799" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VDNPFLGRYFGTCLFFYVIIFLDVFKGRLFRLYVIASFRASFLL" + CDS 39248..39385 + /ID="PHARTEST_CDS_0072" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0072" + /function="unknown function" + /product="hypothetical protein" + /score="-1.277119" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MCYTCINYLHLSLFTQACHWVFFLMIESIVFILLPRSIYDFSIPV + " + ncRNA 39255..39405 + /ID="PHARTEST_ncRNA_2" + /locus_tag="PHARTEST_ncRNA_2" + /product="Small pathogenicity island RNA X" + /Dbxref="RFAM:RF02672" + /ncRNA_class="ncRNA" + /note="SprX" + /score="195.7" + /inference="profile:Infernal:1.1.5" + CDS 39486..39740 + /ID="PHARTEST_CDS_0073" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0073" + /function="unknown function" + /product="hypothetical protein" + /score="-0.4697653" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LISFLPFTRYIYLNNIEILQSLHRILNGVVIFIGSVYQVSVMLKH + QLKMKRIHQCQQVIHSIKTMYRIKKRLVITQLPMLKVIT" + CDS 39744..39878 + /ID="PHARTEST_CDS_0074" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0074" + /function="unknown function" + /product="hypothetical protein" + /score="-12.59126" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAIQLIQELQVYYPITQLSNMTAHIALMAIDGLLILLIVDNVVI" + CDS 39940..40041 + /ID="PHARTEST_CDS_0075" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0075" + /function="unknown function" + /product="hypothetical protein" + /score="-0.216365" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="LIIRYIKVWQVMKCLPNLYIKKKYLPFNLCNYY" + CDS complement(40038..40487) + /ID="PHARTEST_CDS_0076" + /transl_table=11 + /phrog="7039" + /locus_tag="PHARTEST_CDS_0076" + /function="moron" + /function=" auxiliary metabolic gene and host takeover" + /product="chemotaxis inhibition protein" + /score="-86531.41" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKK + LLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYL + NTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY" + CDS 40854..40994 + /ID="PHARTEST_CDS_0077" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0077" + /function="unknown function" + /product="hypothetical protein" + /score="-1.753655" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLILPWAFSRSAFHFLCIAPLRASILNLFLRFPNQCICVILFMGS + R" + ncRNA 40870..41011 + /ID="PHARTEST_ncRNA_3" + /locus_tag="PHARTEST_ncRNA_3" + /product="Small pathogenicity island RNA D" + /Dbxref="RFAM:RF01828" + /ncRNA_class="ncRNA" + /note="SprD" + /score="170.4" + /inference="profile:Infernal:1.1.5" + CDS 40966..41076 + /ID="PHARTEST_CDS_0078" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0078" + /function="unknown function" + /product="hypothetical protein" + /score="-0.7492102" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VLYCLWEVGKHFGAYLFLFFYKYNKVCQFDNLLIFI" + CDS 41170..41520 + /ID="PHARTEST_CDS_0079" + /transl_table=11 + /phrog="4954" + /locus_tag="PHARTEST_CDS_0079" + /function="other" + /product="complement inhibitor" + /score="-21051.94" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEK + LANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKI + YNEIDEALKSKY" + CDS complement(41573..41764) + /ID="PHARTEST_CDS_0080" + /transl_table=11 + /phrog="20340" + /locus_tag="PHARTEST_CDS_0080" + /function="unknown function" + /product="hypothetical protein" + /score="-3.10709" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MAAPFLMTNADYVWTPMTTVTLFILSLIIFLIFIKTKDVVHLTIF + ILNLLFSILYCLPILFYL" + CDS complement(41812..42120) + /ID="PHARTEST_CDS_0081" + /transl_table=11 + /phrog="19469" + /locus_tag="PHARTEST_CDS_0081" + /function="unknown function" + /product="hypothetical protein" + /score="-5.785872" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VKNHTNIINILLVIVNSLTHFLTLNTSFFNSSASDFCFIIGAIFF + LIGIFVAIYGMKRATYWLNLLILFTNIFYFLHFCVLLLLKYIGFKLFIYEGCVLLFT" + CDS 42160..42270 + /ID="PHARTEST_CDS_0082" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0082" + /function="unknown function" + /product="hypothetical protein" + /score="-7.2915" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="MLDEQAVIPNRINKKSRINMLMPHKQPFSLSLLLIS" + CDS complement(42603..42722) + /ID="PHARTEST_CDS_0083" + /transl_table=11 + /phrog="No_PHROGs_HMM" + /locus_tag="PHARTEST_CDS_0083" + /function="unknown function" + /product="hypothetical protein" + /score="-1.864639" + /inference="ab initio prediction:PHANOTATE:1.6.7" + /translation="VSKLETFNIKLLIIQKVKQHNIKVYNFIIINNTPYKIKF" +ORIGIN + 1 atagaaacct tgtaacaaca gtatttattg ggtttggagt ccctaatggg tccctaaatt + 61 acatactttc taaaatttta gttgtttttt tgtcctcttc attaaatttt tcttctaaca + 121 aatgagaata cacggatgta gttattgcta tatttttatg acctaatctt ttagaaatgt + 181 aatgtataga tacacctttt gctagtaaat aagaacaatg agtgtgtctt aatgcgtgcg + 241 atgtaataat tggtatatta ttgactctac aggctgattt caaagcatta ttgatagcct + 301 gaaggttaat tatagatccg gcttctttga aaatgtaacc atcatagcta attgcaaatg + 361 tacttatgac gtccataatg tgtttcatat cagatttagc gatactgata tatctagggg + 421 aagtatcggt ttttcgctcg tcaataaata tagtgttttt cacttggttg atatgctcaa + 481 tctttatatt tcttgcacca ctgacacgac aacccgtaca aatcattatg aatagcgcta + 541 atgatgaacg agttctcttc tttctgacgt gatcttttag tatttcatat tcagttaccg + 601 agatgaattt ttcttgttct gacttcgtag gttttccggc tttataatta actttataag + 661 cggggttttt aaaaataagt ccatcatata atgcgtcatc taaagctgac cgaatagcac + 721 cgtttgtttt tcttatagtt tcttttgcgt gttcttttga atagtcgttt atgaatttct + 781 gataaacttg tctatttatc tttgataact ccattttacc tattttatgt ttttgtatat + 841 gttgtaatgc atttctataa tgacggtagg tattttcttt aacaacaggt tgtttatatg + 901 ttttaatcca attttcgaag tattctgcaa gagttatata gttatctata ttaaaaccac + 961 ttcttaactc atttaacttg tctagtccag cagaattagc ttcacgcttt gttctaaaac + 1021 ctttcttacg gtatcttttt ccttcatgct taaattcata ttgccatttt ttaccatcgt + 1081 aacaacgtgt tttcatgcgt tccctcctca aaattggcaa aaaataataa gggtaggcgg + 1141 gctacccaaa atttagtact aggtactaaa tatgttataa taaaataaaa agtaggtgat + 1201 aagatgactc aatttctagg ggcgcttctt cttacaggag ttttaggtta cataccatat + 1261 aaatatctaa caatgatagg tttagttagt gaaaaaaaca agattatcaa tactcctgta + 1321 ttattgattt tttctattga aacatgtttg atatggtttt atacttttat aatttttaat + 1381 aatgttgatt taaaaaattt gagtttactt cagttgctta caggtctaaa agcaaatatt + 1441 tggtttctaa ttatttttgt tttaacagtg cttgtattta atcctttaat tgttaaattc + 1501 attatctggt taattaatga aacaagaaag tttatgaatt tggattgtat aagcttatta + 1561 gacaaaagag acaagttgtt taataacaac ggtaaaccag tatttatagt tattaaagac + 1621 tttgaaaaca gaatcattga agagggtgaa cttaaaacct ataattcagc tggtagcgat + 1681 ttcgatttac tagaggttga gcgacaagat ttcaaagtat ctgatttacc gtcaaacgat + 1741 gaattgtata ttaaacatac acttgtagac cttaaacaac aaattaaatt ggatttatat + 1801 ttaatgaatg aatattaatc ttttttctta gctttttctg ataaagtgct ttttaagttt + 1861 tcgctggcac ccggcttttc aaaacttttg tttattgggt tactacgagt agcttcttgt + 1921 tttttgtttt tatccgccat aaaattctca ccaccattca acgtctacac ttgtaggcgt + 1981 tttttgttta gtaaaatcat aatgaatctt ctttggttaa cttatcgcca tctaattttt + 2041 gtgaaataaa ttccaagtat ttacgcgcat tatgtgacga taaatcttta ggtaactcat + 2101 aagtgaatgg ttgattacca ctagttaaaa cttcatatac tatagtttct tttttatttt + 2161 gcaattagtt attttcatta taaacttcct ttcaaacact gctgaaatag acgtcttttt + 2221 caaataagca tgattaatac ttcaattctt taatccacat atatttaaaa gtgaggtagt + 2281 aggtaataaa tataagactt aaagttaaga ttgctttttt catgtcaatt tctcctttgt + 2341 ttatatttat attaaagcgc taaatatacg ttattaatca caatacaact ttgcccatta + 2401 ctttaatatc actaaacgaa gcgactttga tatcatcata cttcggattt agagatacca + 2461 aattaatata gtcttcgcat atatctacac gcttgataag acttactcca tctaatacaa + 2521 cgagtgcaat tgtaccatct ttaatagaat cttctttctt aataaaagcg tatgttcctt + 2581 gttttaacat aggttccatt gaatcaccat taactaaaat acaaaaatca gcatttgatg + 2641 gcgtttcgtc ttctttaaaa aatacttctt catgcaatat gtcatcatat aattcttctc + 2701 ctatgccagc accagttgca ccacatgcaa tatacgatac tagtttagac tctttatatc + 2761 catctataga agtgacttta ttctgttctt ccaattgttc atttgcatag ttaagtacgt + 2821 tttcttggcg gggaggtgtg agttgagaaa atatgttatt gatttttgac attatcgttt + 2881 catcttgacg ttcttcatca ggaactcgat aagaatctac atcatacccc ataagccacg + 2941 cttcaccaac gttcagagtt ttagaaagta ggtaaattct atcttggtcg ggtgattgta + 3001 cgtcgttaat atattgagat aaagtgcttt tacttaaaga tatacctagt ttcttttgat + 3061 aaggtttcga tttattaatg atatctactt gttttaagtt tcttattttc ataatgtgtt + 3121 taagtctatt tgaaactttt tctctcattt agtgcacctc cgtttgataa cttcataata + 3181 aagcttgttg aacaaaaatt caacaaaaaa gttcataaat catgaatttt tgtattgact + 3241 tgattcaaaa caaggtgtaa agtatagtta agttcatgat acgtgaactt gagaggaggt + 3301 gcttttatgt gttacgacta ctcacgtttg agcgggaaaa tagtagaaaa gtatggcact + 3361 cagtacaatt ttgcaattgc tatgaaattg tcagagagaa gtttatcctt aaaactcaac + 3421 ggtaaagttg gttggaaaga cagtgaaata tggaaagcta tacaactact agatataccg + 3481 gtagagaaaa tacacttata tttttttaaa gaaaaagttc atgttatatg aacttaagga + 3541 ggggcacaat ggaacaaatc acgttaacca aagaagagtg tgtcgaacaa tgcatcaata + 3601 aagacttaaa acttttagat tatcgagttc aacaaatttt agaaggtgtt ctatcagaaa + 3661 gtaccacata cggtgatgca agaaataaat tagaaacatt gaaaattatt gctgaatctc + 3721 attttaaaac cgaacatgct tcagttattt acaaattagc attgaaaaag ttagacgaaa + 3781 aaatcaacgc cactccaatt aaagagtgac ggaaagggag gattttaaat gtttaaggtt + 3841 ttaaatgata taaaaacttc tttaaaaaac catccttggg gttggaaaga gcacttacct + 3901 tatttgctga tgttaactct gtcacttgtg gctctgattc tcggtgttct gtccgcgatt + 3961 ctatgataac aggctttata tagattcctt tgttggtagt gactttgata gtcacatccc + 4021 attcccatat cactggatat tcttcgagca aaaaagtaca ttctacactt tcataaggtc + 4081 ctaaagtaaa tggaatggag tagtttttat ctttatatcg tataggtttg aacgtttttt + 4141 gttcatttac tttattttta atatcaaatt caacgtcaat aacagaaatg ggaaactttg + 4201 tgaaattaat aaatgttata tcgttgtaac ttgatttgtc atcgaccaag taattaaagc + 4261 ttctggtagg tataacatcg atgttaatag aatctttcat atagtctaaa taatatttaa + 4321 gtgcagtcag taagaaacta aaaattgcga tacaaatcgc gattatgtcc atacttatca + 4381 cctccttagg ttgataacaa cattatacac gaaaggagca taaacaatat gcaagcatta + 4441 aaaacaaaat cgaacatcgg cgaaatgttc aacatacaag aaaaagaaaa tggagaaatc + 4501 gcaataagtg caagagagtt atataaagct ttggaagtta aaaagcgttt tagcgcttgg + 4561 gcagaaatta acttgaagca tttcaaagaa aatagggatt ttacaagtgt acttacaagt + 4621 acggttgtta ataacggagc tgtaagacaa ctagaagatt atgctttaac acttgatgta + 4681 gctaaacatg ttgcgatgat gtcaggtaca gaaaaaggtt ttgattttag agagtatttc + 4741 atccaagtag agaaagcatg gaacagtcca gaaatgatta tgaaacgtgc tttaaaaatt + 4801 gctaacaaca caatcaatca attagaaaca aagattgaac gtgataaacc aaaaattgta + 4861 tttgcagatg cagtagctac tactaagaca tcaattttag ttggagagtt agcaaagatc + 4921 attaaacaaa acggtataaa catcgggcaa cgcagattgt ttgagtggtt acgtcaaaac + 4981 ggattcctta ttaaacgcaa gggtgtggat tataacatgc ctacacagta ttcaatggaa + 5041 cgtgagttat tcgaaattaa agaaacatca atcacacatt cggacggtca tacatcaatt + 5101 agtaagacgc caaaagtaac aggcaaagga caacaatact ttgttaataa gtttttagga + 5161 gaaaaacaaa catcttaata ggaggaacga acaatgcaag ctcaaaacaa aaaagtcatt + 5221 tattactact atgacgaagc cggtaataga cgacccgtta atattcaata caacgatggc + 5281 tacgacttaa tgatagaccc gcgttttatt gaaatgacgc ttgaaagaca tccgcattta + 5341 aaaaataact tttatggatt aatagatgga aaagaattta agttagatta aatttttgga + 5401 aatgcaaagg aggcataaca aatgttacaa aaatttagaa tcgcgaaaga aaaaaataaa + 5461 ttaaaactca aattactaaa gcatgctagt tactgtttag aaagaagtaa caaccctgaa + 5521 ttgttgcgag cagttgcaga gttgttaaag aaggttaact aaattaggcc ttattattac + 5581 tttttagaat gtgaacaata ggtcgataaa aaacttaata aacaaactat agcaactatc + 5641 aatgaatttt gaatatgtaa atcgttctcg tttatatagt ttgttacaaa gatttgaatg + 5701 tcagcacctg ctgcaatgcc attagaccat cttattaact ttttgaaagg atgtggaaaa + 5761 tcattttcga tacgtttgac aaattcatcg tgtctcttgt aggtactttg ctcatttatt + 5821 ggataggtcg aattgatggc ttcagccaaa gtagagatag cagttggatt gatataaaaa + 5881 tctctaatgg tctgttgtgc ttgaagtaca atctcatcat caaacctata gagttcctta + 5941 aaagatttta tcgtttcttc agaaaataaa tttctttgaa atgttagaga tgaaaaagaa + 6001 ttacgcaaat taaaattcat ttcaattaag ttgtttagat gaaagtctac tttgaagtca + 6061 gaaaataaat ttatgttgtt tctattaatt atatctaatt ggtacttagg ttttaaagat + 6121 tgtttaattg ccatactttt agaaatttca acattactaa ttacgttatt aatagaaaaa + 6181 cgaacatttt ttaaaggatc aatatacacc aatatcacct cctttcacta ggagataaca + 6241 acattataca cgaaaggaaa gatagaaatg ccacatattt taaacgtaac agttccaata + 6301 cctgaaacac atgtacttat cacaaaagat gaatatgatg agctaattgg ttattcatta + 6361 gaccctgtat ggaacatgag tgacttaaag aagaaattaa aaattgcatc tgatgagact + 6421 atcaaggaca gattactatt tcatcctaga tttgaaaaag aactaagagc gcaaggaatt + 6481 gtgcattacc cagatgagaa ttttaatcgc tggagattta acgcaagaaa gatgaataaa + 6541 ttcgtcgatg agcatttcaa tgaaatatat aaggagagaa taaaatgagc aacatttata + 6601 aaagctacct agtagcagta ctgtgcttta cagtcttagc aattgtactt atgccgtttc + 6661 tatacttcac tactgcatgg tcgattgcgg gattcgcaag tatcgcaaca ttcatatttt + 6721 ataaggaata cttttatgaa gaataaaaaa actgttactc acggcaatga gtaacagtct + 6781 aaacaattag aaaattaatg catattcaat ataaaacgaa ataaaggaag tgtcaacaat + 6841 gtactacaaa attggcgatg tatgtcaaaa agtaattaat gtagacggat tcgattttaa + 6901 attagcagtt aagaaacaag attacagcat tctagtgaat gtcttagatt tagaagatag + 6961 atttatcgac ggtataaata taacagatga gaatgatcta tacacagcat tagacatatt + 7021 aaatcaatct atttatgaat ggattgaaga gaacacagac gaaagagaca ggctaattaa + 7081 cttagtcatg agatggtagg aggttgctat gaagcagact gtaacttatc taatcaagca + 7141 taaagatgaa aatctattta ttacaaaccg accaactgaa gtgaacgaca cagtgaagta + 7201 ttcaactgat atgcgagacg caagagaatt cgacggacta gacaaaaccg ttattgatat + 7261 gtctaagcac aaagctatta agaaaacagt gacagaaaca attgagtacg agaaggtaga + 7321 acatgactga aaaaactaat caagatgtcg atatcttaac gcaactaggt gtaaaagaca + 7381 tcagcaaaca aaatgcaaac aagttttata aatttgcgat atacggcaag ttcgggactg + 7441 gtaaaactac gtttttaaca aaagataaca acgccttagt actagatata aatgaggacg + 7501 gaacaacggt aacagaagat ggggcagttg tgcagattaa gaattacaag cattttagtg + 7561 cagtgattaa gatgttacct aaaattattg aacaactcag agaaaacgga aaacaaattg + 7621 atgttgtagt gattgaaaca atccaaaagc tacgtgatat cactatggac gacatcatgg + 7681 acggaaaatt aaagaaacca acatttaatg attggggcga gtgtgctaca cgcattgtaa + 7741 gtatttatcg ttatatttct aaattacaag aacattatca attccatctt gctataagtg + 7801 gacacgaggg aattaacaaa gacaaagatg atgagggtag cactatcaat ccaacaatca + 7861 cgatagaggc acaagatcaa ataaaaaaag cggtcatcag tcaatctgat gtgttagcaa + 7921 gaatgacaat agaagaacat gagcaagacg gcgaaaaagc ttatcaatat gttcttaacg + 7981 ctgaaccatc aaacttattc gagacaaaga taagacactc aagcaacatt aaaattaaca + 8041 acaaacgttt cattaatcca agtattaacg acgtagtaca agcaatcaga aatggaaact + 8101 aataaaaaaa ctaaaaagga cggtatttaa ttatgaaaat cacaggacaa gcgcaattta + 8161 ctaaagaaac aaatcaagaa aagttttata acggctcagc agggtttcaa gctggagaat + 8221 tcacagtgaa agttaaaaat attgaattca atgatagaga aaatagatat ttcacaatcg + 8281 tatttgaaaa tgatgaaggc aaacaatata aacataatca atttgtaccg ccgtataaat + 8341 atgatttcca agaaaaacaa ttgattgaat tagttactcg attaggtatt aagttaaatc + 8401 ttcctagctt agattttgat accaatgatc ttattggtaa gttttgtcac ttggtattga + 8461 aatggaaatt caatgaagat gaaggtaagt attttacgga tttttcattt attaaacctt + 8521 acaaaaaggg cgatgatgtt gttaacaaac ctattccgaa gacagataag caaaaagctg + 8581 aagaaaataa cggggcacaa caacaaacat caatgtctca acaaagcaat ccatttgaaa + 8641 gcagtggcca atttggatat gacgaccaag atttagcgtt ttaaggtgtg gtttaaatgc + 8701 aatacattac aagataccag aaagacaatg acggcactta ttccgtcgtt gctactggtg + 8761 ttgaacttga acaaagtcac attgacttac tagaaaacgg atatccacta aaagcagaag + 8821 tagaggttcc ggataataaa aaactatcta tagaacaacg caaaaaaata ttcgcaatgt + 8881 gtagagatat agaacttcac tggggagaac cggtggaatc aattagaaaa ttattacaaa + 8941 cagaattgga aattatgaaa ggttatgaag aaatcagtct gcgcgactgt tctatgaaag + 9001 ttgcaaggga gttaatagaa ctgattatag cgtttatgtt tcatcatcaa atacctatga + 9061 gcatagaaac aagcaagttg ttaagtgaag ataaagcact attgtattgg gctacaatca + 9121 accgcaactg tgtaatttgt ggaaagcctc acgcagacct agcgcattat gaagcagtcg + 9181 gcagaggaat gaacagaaac aaaatgaatc actacaacaa acatgtatta gcgttatgtc + 9241 gcgaacacca taaccagcaa catgcgattg gcgttaagtc gtttgatgat aaatatcact + 9301 tgcatgactc gtggataaaa gttgatgaga ggctcaataa aatgctgaaa ggagagaaaa + 9361 aggaatgaat agactaagaa taataaaaat agcactccta atcgtcatct tggcggaaga + 9421 gattagaagc gctaaaaaaa ttaaaaaatt tacccctgag gattctaaag gttttcctga + 9481 tataacaaaa gattcaataa aagaacctaa ataaaaatat tatggttgat aaaatcccat + 9541 tgttcttttg ttaaccaccc ttgtttgtta ttgactattt ctgtaacaaa cagcttatct + 9601 ccagaatcga gataaggttt caacttttct atcatttctg aagttgataa agaagaacgg + 9661 aataaaaatg aagatttcca ataattgcaa tgaccattag aaatttcctt ttttataaca + 9721 tttctcaatt cctcatattt ttgtccgggt gagtttaaat catatgttaa catataaggt + 9781 ttttccatat tttattcacc cccaatctaa cgcagtagcg ataacaaaat tataccagaa + 9841 aggagataac gaaatggcaa catttagagt ttacaaagaa tcaggtaact ttgtcacagt + 9901 acacaaagat tttatacatg attctaatat aagttggaag gctaaaggta ttctacttta + 9961 tttgttaagt cgacctgata actggcaaat ttacgaaaca gaactagagc aacattcaac + 10021 tgatggactt agcggtttaa agagtggaat caaggaactg gaagaaattg gatacattca + 10081 acgtagtaga aaacgtgata aaagtggtag gttaaatggt tatgagtact tagtatatga + 10141 gcaaccgcac cacattcgat tttccaacgt tggaaaaacc gttaacggta aaaccaacaa + 10201 tggaaaaacc gttaatggta aatcgcatac tactaataat aatagtacta ataatgattt + 10261 aactaataat aacaatacta ataatgaagg aagtatattg tcgggcaacc cgacggtgtc + 10321 ttccattccc tataaagaaa ttatcgaata cttaaataaa aaagcaggaa agcattttaa + 10381 acataataca gctaaaacaa aagattttat taaagcaaga tggaatcaag attttaggtt + 10441 ggaggatttt aaaaaggtga ttgatatcaa aacagctgaa tggttaaaca cggatagcga + 10501 taaatacctt agaccagaaa cactttttgg cagtaaattt gaggggtacc tcaatcaaaa + 10561 aatacaacca actggcacgg atcaattgga acgcatgaag tacgacgaaa gttattggga + 10621 ttagggggat attatgaaac cactattcag cgaaaagata aacgaaagct tgaaaaaata + 10681 tcaacctact catgtcgaaa aaggattgaa atgtgagaga tgtggaagtg aatacgactt + 10741 atataagttt gctcctacta aaaaacaccc gaatggttac gagtataaag acggttgcaa + 10801 atgtgaaatc tatgaggaat ataagcgaaa caagcaacgg aagataaaca acatattcaa + 10861 tcaatcaaac gttaatccgt ctttaagaga tgcaacagtc aaaaactaca agccacaaaa + 10921 tgaaaaacaa gtacacgcta aacaaacagc aatagagtac gtacaaggct tctctacaaa + 10981 agaaccaaaa tcattaatat tgcaaggttc atacggaact ggtaaaagcc acctagcata + 11041 cgctatcgca aaagcagtca aagctaaagg gcatacggtt gcttttatgc acataccaat + 11101 gttgatggat cgtatcaaag cgacatacaa caaaaatgca gtagagacta cagacgagtt + 11161 agtcagattg ttaagcgata ttgatttact tgtactagat gatatgggtg tagagaacac + 11221 agaacatact ttaaacaaac ttttcagcat tgttgataac agagtaggta aaaacaacat + 11281 ctttacaact aactttagtg ataaagaact aaatcaaaat atgaactggc aacgtatcaa + 11341 ttcaagaatg aaacacaatg caagaaaagt aagagtaatc ggagacgatt tcagggagcg + 11401 agacgcatgg taaccaaaga atttttgaaa attaaacttg agtgttcaga tatgtacgct + 11461 cagaaactca tagacgaggc acagggcgat gaaaataagt tatatgacct atttatccaa + 11521 aaacttgcag aacgtcacac acgccccgct gtcgtcgaat attaaggagt gttaaaaatg + 11581 ccgaaagaaa aatattactt ataccgagaa gatggcacgg aagatattaa ggtcatcaag + 11641 tataaagaca acgtaaatga agtttattct ctcacaggag cccatttcag cgacgaaaag + 11701 aaaatcatga ctgatagaga cctaaaacga ttcaaaggcg ctcacgggct tctatatgag + 11761 caagagctag gattacaagc aacgatattt gatatttaga ggtggcacaa tgagtaaata + 11821 caacgctaag aaagttgagt acaaaggaat tgtatttgat agcaaagtag agtgcgaata + 11881 ttaccaatat ttagaaagta atatgaatgg cactaactat gatcgtatcg aactacaacc + 11941 taaattcgaa ctacaaccta aatttgggaa gcaaagaccg attacgtata tagccgattt + 12001 ctctttgtgg aaggaaggga aactggttga agttatagac gttaaaggta aggcgactga + 12061 agttgccaac atcaaagcga agatattcag atatcagtat agagatgtga atttaacgtg + 12121 gatatgtaaa gcgcctaaat acacaggtca agaatggatg gtatatgagg acttagtgaa + 12181 agtcagacgt aaaagaaaaa gagaaatgaa gtgatttaat gcaacaacaa gcatatataa + 12241 atgcaacgat tgatataaga atacctacag aagttgaata tcatcatttc gatgatgtgg + 12301 atgatgaaaa agatatgcta gcaaagcgct tagatgacaa tccggatgaa ttactaaagt + 12361 atgacaacat aacaataaga catgcatata tagaggtgga ataaatggcg aaagcagcaa + 12421 gaattgtaag gatacacgat aaaccttata ggttcagtaa atttgaaatg gaattaatag + 12481 aaagtcacgg tataaccgct ggaatggttt ctaagagagt aaaagacggt tgggaactac + 12541 atgaagcaat ggacgcacca gaaggtacgc gtttaagcga gtacagagaa aagaaaacaa + 12601 tagaaagact ggaacaagct agactcgaac gcaaattgga aagaaagcga aagagagagg + 12661 ctgagctaag aagaaagaag ccacacttgt ttaatgtacc tcagaaacat tcacgtgatc + 12721 cgtactggtt tgataatact tataaccaaa tgttcaagaa gtggcaggaa gtataaatgc + 12781 ctaaaaccga tagcgcatgt aaagaatact taaaccaatt tttcggctct aagagatatt + 12841 tgtatcagga taacgaacga gtggcacata tccatgtagt gaatggcact tattactttc + 12901 acgggcatat cgtaccaggc tggcaaggcg tgaaaaagac atttgataca accgaagagc + 12961 tcgaaacata tataaagcaa catggtttgg aatacgagga acagaagcaa ctaactttat + 13021 tttaaggaga tggaaataat gaaaatcaaa actgcaagca tagaggtcga aaaagtggag + 13081 gtagtagtat gatgccgaaa tttagagcgt gggataaaga taaaaaagtt atgagtttta + 13141 ttgacgaaat cgattttaat agtgggtaca ttttgatttc aacaggttat aaaagtttca + 13201 atgaagtaaa actattacaa tacacaggat ttaaagatgt gcacggtgtg gagatttatg + 13261 agggggatat tgttcaagat tcttattccg gagaagtaag ttttatcgag tttaaagaag + 13321 gagcctttta tataactttt agcaatgtaa ctgaattaat aagtgaaaat gacgatatta + 13381 ttgaaattat tggaaatatt tttgaaaatg aggagctatt ggaggttatg agatgacggt + 13441 caccttatca gatgaacaat ataaaaacct ttgtactaaa ttaaacaagt tattaggtaa + 13501 atttcacaaa gcattaaaag aacgtgatga gtacaagaag caacaagatg agcttatcgt + 13561 ggatataggt aagttaagag aacgtaacaa agagttggag aacatgtggc gcactcttaa + 13621 aaatgaattg cttggaagat acgaacatta ctgttttaaa tttagagaac tacaccctga + 13681 gagcaaagcg aacaggatag gagctctcta tataggaggt aaaagcactg cagatattat + 13741 aatgtcgcga atggaagaac tagacggaac aaatgagttc tacgaatttt tagggcaaat + 13801 ggaggaagac acaaatgaat aaccgtgaac aaatagaaca atccgttata agtgctagtg + 13861 cgtataacgg caatgacaca gagggattac taaaagagat tgaggacgta tataagaaag + 13921 cgcaagcgtt tgatgaaata cttgagggaa tgacaaatgc tattcaacat tcagttaaag + 13981 aaggtattga acttgatgaa gcaataggga ttatggtaag tcaagttatc tatgaataca + 14041 aggaggaact ggagaatgaa aaaatttaat gttcaaatca catatacagg catgattgaa + 14101 gaggctatcg aggctgaaag tttagaagaa gcagaatttg aggctcatga tattgcgaga + 14161 atggaagtgc catttgattg tgatgaattt gaaattaatg tagaggtgga acaggaaaat + 14221 gaataacaca ttaacaattg atcaattaca agagttatta caaatacaaa aagagttcga + 14281 cgatagaata ccgacgctga acttacgaga tagcaagatt gcatatgtag ttgaattctt + 14341 tgaatggttt aatacattgg aaacgtttaa gaactggaag aagaaaccag gtaagccgtt + 14401 agacgtacaa cttgatgaat tagctgacat gttggcgttt gggttgagta ttgcgaatca + 14461 agtaggagtg tcatcagaag agataaaaga agcgattgaa tcaagtttta aaaatacaga + 14521 atttcacaaa atgtttaatt ttaaagataa agaatttgct caagacgcag ttgttagtac + 14581 accacagata atattcaaag aattttatcc cgaccaattg gcaattgtaa tagtgataga + 14641 catagcttac aacttatatt ctatcgacca actcattgac gcatacaaaa agaaaatgaa + 14701 aaggaaccac gaaagacaag atggaacagc agacgcagga aaaggatacg tgtaaagaca + 14761 tcttagatcg agttaaggag gttttgggga agtgagagaa cgcactaaaa ttatatatcg + 14821 tggttggaac aaggagatat ttattttaca gggtaaaaat atgaatgtta ttggtttgcg + 14881 ccaaatattt gatgaactca aaagattgta cgaaggttat aaaatcgttg ttattccaat + 14941 agaagttgat tttgaaatca aataaatagg agtgatgaga agtgacacaa tacttagtca + 15001 caacattcaa agattcatca ggactaccac atgaacattt tactgctgct agagataatc + 15061 agacgtttac agttgttgag gcggagagta aagaagaagc gaaagagaag tacgaggcac + 15121 aagttaaaag ggatgcagtt attaaattag gtcagttgtt tgaaaatata agggagtgtg + 15181 ggaaatgatt aagcaaatat taagattatt attcttacta gcgatgtatg agctaggtaa + 15241 gtatgtaact gagcaagtat atattatgat gacagctaat gatgatgtag aggcgccgag + 15301 tgattacgtc tttcgagcgg aggtaagtga gtgatgtgga ttactatgac tattgtattt + 15361 gctatattgc tattagtttg tatcagtatt aatagtgatc gtgcaagaga gatacaagca + 15421 ctcagatata tgaatgatta tctacttgat gaagtagtta aaactaaagg atacaacggg + 15481 ttagaagaat acaggattga attgaagcga ataaataacg atattaaaaa gtaatttata + 15541 ttatcggagg tattgcatgt ataacaggaa agaaatacgt gaaatgatag ataactacaa + 15601 gtggatgaag aacataatag acagtaaagt ctacgataac gaaagtacat caattgcaca + 15661 atatggttat caatctgcga tgccaaaagc taaaggcacg actagcaata aagtgttagt + 15721 gaaagttata aacaaaaaca aagcgcttag aaagtacgat tacttgatta agaagatagc + 15781 gttcattgat gaatatgaag aatacatcac gaatgaaaaa gattatcata ttttacaaat + 15841 gttaaaacaa cgagaaagcc ataataggat catgagcatt cttgatatag gcagagacaa + 15901 tttttattct agagtaaaag atatagtaaa tatactttat aacttgcaac aagaaaccga + 15961 cagttcggac acatcgtaca gttcggacac atcgtacagt tcggacacat cgtacagttc + 16021 ggactaattt tgatgctaca tattgttttt tattataatt gctgtgtagc aaaacattta + 16081 tatttctttt gaactctcac attaagtgag ggtttttatt tttataaaca agaggtggag + 16141 aatggagata tcaaagtacc aagagatagc tacacgtaca cacaatgatg aattgaattt + 16201 aaatgaatat attacttgtt acggcttagg tttaactcaa tctacaggca atgttacaga + 16261 tctaattaaa cagcatatgt tttgtaatgt accgatagat aaaggaatta tgataaatga + 16321 acttagcgaa gcattgtgga atatagctaa tcttactaac gtgttaggta ttaacttgga + 16381 tgagatagct ggtcatagtg ttaacactat cttgatgaat aaacctaatc agactatcaa + 16441 tttagacaat ggtataaaac gaggagacaa agtattgttt caaggtagta agtatcttgt + 16501 tgatggatcg ataggaaact tattgttaat tagcaatgat aaagatgata gacaagtaac + 16561 tgtgcaagat gttaagaaag tcgacaagga gtgatgtgca ttgtctatta tgaagcgatg + 16621 tggtcatcca acatgtaatg tattgattaa tcataatgaa agttattgtg ataaacacaa + 16681 gcaatatgca aatgaaaatt acaatgattt gagacgtcga aacgatccag agtatttaag + 16741 attttataaa tcgaaaacgt ggcaaaacat gcgtcgaatt gtattgttag aacatgattt + 16801 tatttgtgtt tcttgtggca atcaagcgac tatggttgac catattgtac caacaaaaat + 16861 tgattgggca agaagattag acaaaagtaa tttacagcct ttgtgtgatg cttgccataa + 16921 ccaaaagaca aaagaagatt tgaagaaata ttaaaaaaga taaaaatagg aagtcacccc + 16981 aaagatgaaa cgggcgtcaa tgaaaggttc tggagaacgg agcagagttt tcttctcaaa + 17041 aaattccctt tatttaagtt tttttagtag gaggtgctaa tttatggcgg gtagacctaa + 17101 gaagcttttg tcaaattcga acaagaatta tacaaaagaa gaaattattg aaaaagagcg + 17161 tcaagaagct caattaaata aattttctaa aatcgatact gaaccaccgc actttttaga + 17221 tgaaatagcg aaacaagaat acttaagaat attaccgcac atgcaagaat tgccaatttc + 17281 caacttagat aaagcacaat tagcacaata ttgtagtttt tatagtgact ttgttaaagc + 17341 aagtttgatt ttagagcgcg aagacttgat tttagaagac gacaaaggaa atcaaaaggt + 17401 taatccggcg ttcaacataa aggaaaaagc gggtattcga ttgcaacaaa cagctaatac + 17461 tttaggatta actattgata gccgattgcg tattatggtt cctgatgaaa aagaagatga + 17521 tgatccatat atggaatttg tgagtgatta gtaatgactg attatgttac taaatacgca + 17581 aaaaaggtag tttcaggaga aattttggca agtttgaaga atattcaagt atgtaaacgt + 17641 cacctatctt ttatggagaa cccgccgaat ggttgccatt gggataatca tttgtctaac + 17701 aaagcaatta aatttgtgga aatgcttcca gaccctaaaa caaaccagcc catgcctctt + 17761 atggagtttc agaaattcat tgttgggagc ttatacggct ggcgtagagg tcaatacaga + 17821 atgtttacta aagcttatat aagtatggct agaaaacaag gtaagtctct aatcgtatcg + 17881 ggaatgtccg ttaacgaact gttgtttgga caatacccta aatttaatag acaaatttat + 17941 gtagcttcat ctacttataa gcaagcgcaa acaatattca agatggcaag ccaacaagta + 18001 aacctaatgc gaagtaaaag caagtttatc cgtgaaaaaa cagacgtaag aaagacagac + 18061 attgaagatg tattaagtag ttcagtgttt gcacctcttt ccaataaccc agatgcggtt + 18121 gatggtaaag atcctacagt tgctattttg gacgaattgg caagtatgcc tgatgatgag + 18181 atgtactcaa ggtttaaaac aggtatgaca ttacaaaaaa atcctttaac cctacttgtt + 18241 tcaacggccg gagacaattt aaatagtcaa atgtaccaag agtataagta tattaaacgt + 18301 attttaaatg aagaagtaag agctgataat tactttgtat attgtgctga aatggattca + 18361 caagaagaag ttcaagatga aacaaagtgg attaaagcaa tgccgctttt agaatcaaaa + 18421 gaacatagaa aaactatact tcaaaatgta aaagctgata tacaagacga attagaaaaa + 18481 gggacatcat atcataagat tttgattaaa aacttcaatt tatggcaagc gcaaagagaa + 18541 gatagcttgc tagatatttc agattgggaa caagtaataa cgcctatgcc taatatcaat + 18601 ggtaaagatg tgtatatagg tgtcgactta tcgagattgg atgacttaac atctgtaggg + 18661 tttattttcc ctaacgacga taaaaaagtg tttttacata gtcattcttt cattggatta + 18721 agaacaaact tagaacaaaa atctaagaga gacaaaataa attatgaatt agcgattgaa + 18781 cgtggcgaag ctgagactac acaatcagat agcggcatga ttgattataa acaagttatc + 18841 gattttatag tgaaatttat aacgacgcat gacctgaatg tacaggctgt ttgctatgac + 18901 ccttggaatg cgcaaagttt tataacaaca atcgaatcaa tggctttaga ttggccactc + 18961 attgaagtgg gacaaagttt taaggcgtta tcacaatcta ttaaagaatt tagaatgtgg + 19021 gttgcagatg aaagaataca gcataacgat aatatgttac ttacaacatc agttaataat + 19081 gccgttttga ttcgtgacgg agaagacaat gtgaaaataa ataaaaaaat gaatcgtcaa + 19141 aaaatagatc cgattatttc gattatcaca gctttcactg aagctagaat gcacgaattc + 19201 caagaaaatt ggacggagaa atatgaaagc gaagaattcg gattttaaag gtggtgacaa + 19261 aatggacttg aataaaataa atgtcttttt taatttcttg gttgctaatt tggttagcat + 19321 ccttttttta ttaggtttgt ttgtggttaa tgtttctgtg tataaagcat tcggtcaaaa + 19381 tataggactt ttatgcattg gtataacact gattgttatt tcgttgattt taaatcacga + 19441 aagcaatcaa gaaaggagtt agtagttgtg gggatttttt ataaaaatga aaaacgagac + 19501 ttgcaataca acgaagatga tttgcaaatg atggttcaaa ctttgccagg ttttcaagga + 19561 acaaaattac gacaatataa agatatagaa gcaattaggc atagcgacat ctttacggca + 19621 gttatgatga ttgcttctga tttggcgcgc atgccaatta gggtgacagt gaacggccaa + 19681 attaattata gtgacaggat tgttaatttg ttaaatacac gtcctaaccc aatgtataac + 19741 ggctatatat tcaaattagt agtgtttgtt agtgccttac taacatcgca cggctatatt + 19801 gaaattacac gtgataaaac aggagaacct atgaatttaa cgttcagaaa gacatccgaa + 19861 atagaattga aatcagacgc aagaggtcga ctgtattatt ttcatcaaag gatagacagt + 19921 aacggaaata atatagaacg taatgttaag tttgaggata tgctagacat caaattttat + 19981 tcgttggatg gtataaatgg tttgtcactg ttagacacat taagtcgcac gatagaatca + 20041 gataacaatg gaaaagattt ccttaataat ttcttgcgaa atggcacaca tgctggtggt + 20101 attttgaaaa tgaaaggtgt attagataat aaaaaagcaa gagaccgtgc cagagaagaa + 20161 tttcacaaaa gttttagtgg aactaaacaa gctgggaaag ttgtcgtact cgatgaatca + 20221 atgacgtttg atcaattaga agttgataca gaagttttaa agcttatcag agaaaacaaa + 20281 tcatcaacaa gagaaatagc aggtgtattt ggtattccat tgcataagtt cggcatagaa + 20341 acagcgaaca tgagtatcac ggatgctaat ttagattact tatcaacttt aaaaccttat + 20401 attacatgcg tttgtgcaga attgaatttt aagtttaatg atgaatatgt gaatcgtgaa + 20461 tttaaatttg ataccactga aatacgagtt gttgatgaaa aaacacaagc tgaaattgac + 20521 aaaattaaca ttgattctgg aaagatgaat atcgatgaaa ttagacaacg tgatggatta + 20581 gcgccaatac caggcggtaa tggtagcatt cacagagtcg atttaaacca tgtaaatatt + 20641 gaacttgtag atgagtatca gatgaataaa tcgagagcta ctgataaaaa attgaaaggt + 20701 ggtgaggaaa atgagtaagg aaacgagagt tggcaacatt attgaggtac gctcaaatga + 20761 taacaacgaa atggtcatag aggggtatgc gttaaagttt gacacttggt ctgaaaatct + 20821 tggtggattc aaagaaacga tttcacgtcg cgctttagaa aacactgatt tatctgatgt + 20881 gcgttgttta gtagatcata tcccatcgca aataattggt aggacaaaat cgggtacttt + 20941 ggagctcgaa actgatgatg ttggacttaa atatcgttgt aagttaccaa acacaacatt + 21001 tgcacgtgat ttatatgaga acatgcgtgt aggcaacatc aatcaatgtt cgtttggttt + 21061 tatgcttgac gataaaggcg atgaagtgcg ttttgatgaa caagaaaaca tttacaaacg + 21121 tactttaaca gcaattcgtg aacttacaga tgtttctgta gtgacttatc cggcttacaa + 21181 agacactgat gttaaaccag cattacgtag tattgaaacc gttaaaaaag aacaacgtaa + 21241 aaaagaatta gaaataagac taaagaaaca ctctatatta aataatattt ggtgaagttg + 21301 aacaccatta tcaaatacag ccattggaca tgctgaatat agcgatgtct atttttttat + 21361 gccaatttta ggaggaaatt aaatgaaaac aaaagaagag ttacaatctg agatttcaga + 21421 cattaaaaga caaattgatt taaaggtgaa gtatgcaacg agagcactta ataacgatga + 21481 gttagaaaaa gcagaaaaat tagaacaaga aattactgat ttacgttctc aaatccaaga + 21541 aaaacaagaa gaattagata agctaaaaga aaaagatgga acttcagaaa acaatcaaca + 21601 atcagtggaa gtaaacgaag caagtactta tcgaaatcaa gcaaacatta atgatttagg + 21661 tatttcgatt caaaacacaa aggtaacatc acaagaagtt agagatttta ctgaatatct + 21721 tgaaacacgc aatgatattc aaggtggttc gttaaaaaca gactcaggat ttgtagttat + 21781 tccagaggaa attgttacag atattttaaa attaaaagag gttgagttta atcttgataa + 21841 gtatgtgacg gtcaaacgtg ttacaaatgg ttctggtaaa tatccggtag tacgacaatc + 21901 agaagttgca gcccttgaaa aagttgaaga attagaagaa aaccctgaat tagcagttaa + 21961 accattcttc caattagcat atgacattaa tacacaccgt ggttacttcc gaatttcacg + 22021 tgaagcaatc gaagatgcaa aagtgaatgt tttgcaagaa ttgaaactat ggatggcgcg + 22081 aactattgca gcaacacgaa acaaagcaat tattgatgtt atcactaaag gatcaacggg + 22141 ttctacaagt tcaggttttg aaaaagaagg caagaaatta gaagttaaaa aagcaaaatc + 22201 tttagatgat attaaagatg ctattaacct gaatgttaag ccaaattacg aacataatgt + 22261 tgcgattgtt tcgcaaacta tgtttgcaaa attagacaaa atgaaagata agctaggaaa + 22321 ctatttaatc cagccagatg ttaaagaaaa aacgcaacag cgtttattag gagctaaaat + 22381 cgaaatttta cctgatgaag tactagggca aaaaggtaat aacactttga ttatcggtaa + 22441 cttaaaagat gcgattgttt tatttgaccg ctctcaatac caagcatcat ggactgacta + 22501 catgcatttc ggagaatgtt taatgattgc tgtacgtcaa gactgtagaa ttctagatta + 22561 taaatcagca attgtgattg aatatgatga tagtgaacgc ggtgaaggcg atcttggctt + 22621 agaagcataa taagcgctcg atactttata aagaggtgat aaactatggc aatgtatgaa + 22681 gtgaagaaat cttatactga cttggaaaaa ggccagtatt taaagtcagg taaacgtgtt + 22741 gaaatgacag taaaacgtgc tgaatatgtt aacaaaaagc tgaaagagca tggagtaata + 22801 cttgaaagag taaaagaaga ataggtgatt gaatgcaatt aacagctgag gaacttaagt + 22861 tattaaaaaa gcattgcaaa atagatcaca attcagagga cgacttatta gaaatatatt + 22921 actcttgggc attccgtgaa atagctagcg ctgttacgga taaaccaagt aaatatattg + 22981 attggtttaa aagtcatcct ctatttgctc gtgctatata ccctttagca agttactatt + 23041 ttgaaaaccg tattgcttat ttggataggg atttatcgct tgcgccacat atggttttaa + 23101 gtacggtgca taaattgaga ggttcatttg agcaattttt ggagagtgaa aatgatgaaa + 23161 tttaattcca ataaattaaa tgaacgtata gatttttgtg aagatgtaag cgagagagtg + 23221 aacggaaatc cgatgaaacc gaagacgaaa atattatact cttgtttcgc ttgcattcaa + 23281 gaatctaaag aatccgacac tcaaacgaat ctcaatacag gtagcaaatt cattaaaact + 23341 attattatca gagatacacg aggtgattat aaaccaacaa ataagcatta cgtcttgcat + 23401 gaagggcaaa gatttaacat caaatatgta aagccagatt atcaagataa atcttatttg + 23461 cgtatctatg gcgaggtggt catttaatgg gggcaagaat tgaaagtaat aacatcgaac + 23521 aaggtttgaa aaatgcagtt ttaaaaatga atttaaatag taatgtaatt gtcaaagctg + 23581 gggctatgtc attagtcccg cttttaaaaa gtaatacacc ttttgcgaat actaaaaagc + 23641 atgctcgcga tcacatagct gtttctaatg tgaaaacaga cagacacaca agtgagaaaa + 23701 ttgttacaat tggttacgct aaaggcgtct cacatcgtat tcatgcaaca gaatttggaa + 23761 caatgtacca aaaaccacaa ttgtttataa caaaaacaga aaagcaaggg aaaaacaaag + 23821 ttttaaaaac aatgcttgat actgctaaga ggttgcaaaa atgattaatg ttaccaaatt + 23881 aattagaaac gctattattg caaataacat tacagatgaa gtgaatgtgt ttaactacac + 23941 tatagatgac cattttcacg aaaaaactga caagcctatt attcgtatat atcccttacc + 24001 gttcaatcct gacacatacg ctgatgataa cgagatttca agagaatacc attaccaaat + 24061 tgatgtttgg tggtctcaag atgaaccgaa cgagcaagca gaaaaaattg ttgagttact + 24121 caaagtgata aattttcaat gttattacag agaaccgtta tacgagagtg acgtcatgtc + 24181 attcagacat attataagag caaaaggctc gattttatca atgaaattgg aggaaaatta + 24241 aatgattgaa aaattgaaac aagcaccaag atttttaaaa ttaaacttac aacattttgc + 24301 agatacagga gtttcgggta tcgcaattgg ggtatcaaac ttttattatg cacctatttt + 24361 aaaagataca gaaaatgaat gggaaactgg agctggcaca cgtattcgtt tcttaaaaga + 24421 aattgaagta gaccgtccac aagataccga ggaagattat ggggatgata tggtcgcagc + 24481 aactgctgta tctaatggca aactaagtgt taagacaaca tttgttactg ttcctgctga + 24541 cgataaggcg ttcttgaatg gcgctaaaaa aggtgtaggt ggttataaat atggagctaa + 24601 ggatatcccg ccagatgtag cgattgtatt tgaaagacgt aatcatgatg agtcttcaga + 24661 atgggttggc ttgttcaaag gtaaattcac tcgttcaagc atcaaagggc aaacaaaaca + 24721 agataaagtt gaattccaga atgacgacgt agaaggcaat tttattgatc gtttgtttga + 24781 tgagagctcg catgttactg gctatgataa aaaaggaagc actacagggc gcgattatgt + 24841 attcatggaa acatttggta aaacttatga tgaattcatg tctagtcgag gagaacaaaa + 24901 tatggaacct gtagaaaaag aaatgaaaaa aacagaaaaa gttgaagtca cttctgtaaa + 24961 cgtcactgat gaacaagtta cagttaaagt tgatgctact aaacaactat cagccacaac + 25021 cgaaccatct ggacagaaag taacttatgc agtgactgag gggcaaacgt atgctagcgt + 25081 aacatcaact ggcctcgtta aaggtttggc ggaaggtaat gcgaccgtta cagcgactgc + 25141 aggaaagcaa actgatactg tgcaaattac agtacaatct aatttagaaa tgtaagtttt + 25201 gagggcttaa cgccctcttt ttattttggc caaattaaaa agaaagtagg aatttaataa + 25261 tggaacgtac atcaattgaa ttaattacag gatttacaaa aacaggaaag ccgcaatatc + 25321 aaaagtattt agcgaagccg attattactt tgtttgaaac aattcaaggt tcaaaattag + 25381 gtttgaaact taacaaagcc tttaaggggg ctgattttaa agatctaaca gaagaagaat + 25441 ttaataactt aagtgtgaca gaacaggaag aatacaaaaa caagcaagaa gaatacgaaa + 25501 acaacatggc tgtacaaatg gaagtattag aagaagtttt ggatttcatc gttgaagctt + 25561 ttgataatca atttaccagt atagaacttc aaaaaggatt accaaatggt caagaaggta + 25621 ttgaaaagat tggacagtta attggacgaa ttacaggtgg ggaacctagc gatacaaaaa + 25681 agttcgtgac agagaatcag aaataagaaa agaagattta acacctgaag ctgtctacaa + 25741 caattacagg aaaatagcta aagatttgat agaaaaaggc atggatgcag aaaaagtggc + 25801 taacatgccg atacacttct ttttagacat tgtcgaatcg aagattgaaa caaagcgaac + 25861 tgcgaaaagt tttaaagata ttttttaatc agcctttaaa ggttgatttt ttatttacat + 25921 cttggaagaa aggaggtttt taaatgccta atcctatagg taatatggtc ataaaggttg + 25981 atttagatgg ttctggattc aatagaggtg tgacaggttt aaataggcaa atgaaaatgg + 26041 tttcgcgtga gctttcggct aatttatcac aattttctag atatgataat tcattagaaa + 26101 agtcgaagat aaaagtcgaa ggtttgagta aaaaacaaaa agttcaagcc cagattacta + 26161 aagagctgaa agatagttat gacaaactta gtaaagaaac tggtgaaaac agtgcaaaga + 26221 cacaagctgc ggctgctaaa tacaatgaag cttacgctaa attaaaccaa tatgagcgag + 26281 agttaaatca agccacacaa gaattaaaag acatgcaaag agagcagaaa gcattaaata + 26341 ctgcaatggg aaaacttggt accaacttta ataattttgg tcctaaactt caagaaattg + 26401 gtaacagtat gaaaaatgta ggccgtaaca tgactatgta tgtaactgcg ccggtggttg + 26461 ctgggtttgc tgtagcagct aaaaaaggta ttgaattcga tgacagtatg agaaaagtta + 26521 aagcaacttc aggtgctact ggggaagagt ttgaagcttt gaagaaaaag gctcgcgaaa + 26581 tgggtgcaac aacaaaattt agtgcatcag attcggctga agcattaaat tacatggcac + 26641 ttgctggttg ggattctaag caaatgatgg aaggtttaag cggagttatg gatttagcgg + 26701 cagcatctgg cgaagaactg gaagcagtaa gtgacattgt tacagatgga ctaacggcat + 26761 tcggtttaaa agcaaaggat agtggtcatt ttgcggacat tttagcacaa actagctcga + 26821 aggcaaatac ggatgttaga gggctcggag aagcttttaa atatgtcgct cctgtagcag + 26881 gtgcgttagg ttacacgatt gaagatacat ctattgcgat aggtttaatg agtaatgctg + 26941 gtatcaaagg tgaaaaagca ggtacagcgt tacgaacaat gttcaccaat ctttcaagtc + 27001 caactagagc tatggggaat gaaatggaac gcttaggaat atctattaca gatagtaatg + 27061 ggaaaatgat tcctatgcga aagcttttag accaactgag ggaaaaattt aaacatcttt + 27121 caaaagacca acaagctagt tctgcagcta caatatttgg taaagaagcg atgtcaggag + 27181 cattagcgat tataaatgct tctgatgaag actatcaaaa gttaaccaaa tctatagatt + 27241 catctaccgg cgcatctaaa agaatggccg atacaatgga atctggttta ggtgggaaat + 27301 taagaacttt aaggtcgcaa ttagaagaac tagccttaac gatttatgac agaatagaac + 27361 cagcactaaa gattatagta agtgctttta gcaaagtagt gacatgggtt actaaattac + 27421 caacgtcaat tcaattagcg gttgttgggt ttggattatt tgcagcagtt ttaggtcctt + 27481 tagtttttat gttcggttta tttatcagcg tgatggggaa tgcaatgaca gttttaggac + 27541 ccttgttaat aaacgttaat aaagctggtg gtttattcgc gtttttaaga actaaaatcg + 27601 catcacttgt taaactattt ccgattttag gtgtgtcgat atcaagttta acgttaccta + 27661 taacattaat tgtaggtgca ttagttggta ttggcatagc tttctatcaa gcttataaac + 27721 gttcagaaac ttttagaaat attgtaaatc aggcaatctc tggtgtagca aacgcattta + 27781 aagcagctaa actagcgtta caaggtttct ttgatttatt caaaggtgat agtaaaggcg + 27841 cggttaccct agagaagata tttccacccg aaactgtagc aggaatacaa aatgtagtta + 27901 atacgattag aacaactttc tttaaagtag ttgatgcaat cgttggtttc gccaaagaga + 27961 taggcgctca attagcctct ttctggaaag agaacggctc agaaataaca caagctttgc + 28021 aaaatatagc tggtttcatt aaagcaacct ttgaatttat ttttaacttt attattaaac + 28081 caatcatgtt tgcgatttgg caagtgatgc aatttatttg gccggcggtt aaagctttga + 28141 ttgtcagcac ttgggaaaat atcaaaggtg taatacaagg ggctattaat attattttgg + 28201 gtattatcaa agtgttctct agtcttttca caggaaactg gcgaggcgtt tgggacggca + 28261 ttgtaatgat actgaaaggt actgtgcagt taatttggaa tttaatacaa ctgtggtttg + 28321 taggtaagat tctaggtgtt gttagatact ttggtggatt gcttaaaggt ttaatatccg + 28381 gtatctgggg tgttatcaaa ggtattttca caaaatcatt atctgcaatt tggaatgcaa + 28441 cgaaaagtat ttttggtttc ttatacaata gtgttaaatc tattttcact aatatgaaaa + 28501 actggttatc tagtacgtgg aataatatca aaagcaatac cgtcggcaag gctcattcgt + 28561 tatttacggg tgtaaggtct aaattcacaa gtttatggaa tgcgacgaaa gatatattta + 28621 ctaaattaag aaattggatg tcaaacatct ggaactctat taaagataac acggtaggta + 28681 tagctggtcg tttgtgggat aaagtacgta atatcttcgg aaacatgcgt gacggtttaa + 28741 aatctatcat tggtaaaatt aaagatcata tcggcggtat ggtagatgct attaaaaaag + 28801 gacttaataa attaattgaa ggcttaaact gggtcggtgg taagttaggt atggatgaaa + 28861 tacctaggtt acacactggt acagagcaca cacatactac tacaagatta gttaagaacg + 28921 gtaagattgc acgtgataca ttcgctacag ttggggataa aggacgtgga aatggtccaa + 28981 atggttttag aaatgaaatg attgaattcc ctaatggtaa acgtgtaatc acacctagta + 29041 cagacactac tgcttattta cctaaaggct caaaagtata caacggtgca caaacttatt + 29101 caatgttaaa cggaacgctt ccgagatttc atttcggtac tactatgtgg aaagatatta + 29161 aatctagtgc atcatcggca tttaactgga caaaagatca aataggtaaa ggcacaaagt + 29221 ggcttggcga taaagttggt gatgtcatgg actttatcga taatccaggc aaacttttaa + 29281 attatgtact tcaagcgttt ggagttgatt tcagttctct aactaaaggt atgggtattg + 29341 ctggcgatat aacaaaagct gcatggtcta agattaagaa aagtgcaatc aagtggcttg + 29401 aggatgcttt cgcagagtcg ggtgatggcg gtgtattaga tatgagtaaa ttacgttact + 29461 tatacggtca cactgctgct tatacacgag aaaccggacg cccattccat gaaggtctgg + 29521 attttgatta catttacgaa cctgttccat caaccattaa tggtagagca caagttatgc + 29581 ctgttcataa tggtggttat ggaaaatggg tgaaaattgt aaagggcgcc ttagaagtta + 29641 tttatgcaca tttatctaaa tataaagtta aaactggtca acaagttagg gtcggacaga + 29701 ctgttggtat atcggggaat acggggttta gtacaggacc tcacttacat tatgagatgc + 29761 gttggaatgg aagacataga gacccgttac cgtggttaag aaagaataat gggggcggca + 29821 aaagtacacc cggtggtaat ggtgcagcta atgctagacg agctattaag gctgctcaaa + 29881 atattttagg aggaaggtat aaggcgagtt ggattactaa cgagatgatg cgtgttgcga + 29941 gtcgtgaatc caattataca gctaatgcag tcaataattg ggatagcaac gcaagagctg + 30001 gtataccttc aagaggtatg ttccaaatga tagatccttc atttagagcg tacgcaaagt + 30061 cgggttacaa taatcctctc aacccaactc atcaagctat atcggctatg agatatattg + 30121 tgggtaaatg ggtaccaaga acaggctcat ggagagctgc gttcaaacgc gctggtgatt + 30181 acgcatatgc tactggtggc aaagtctata acggattgta tcacttaggg gaagaaggat + 30241 atccagagtg gataatacct actgatccaa gtagagcgaa cgaagcacac aaattattag + 30301 ctttagctgc taacgatatt gataaccgct ctaaaaataa gcgaccaaac aacttaccaa + 30361 atccaagtat aagtaatagt gatacaaact atattcatac attggagaat aaactggatg + 30421 cggttattaa ttgtttggtt agtttggttg agtctaatca agttattgca gataaggatt + 30481 acgaaccagt tattaataag tatgtgtttg aagatgaggt aaataattct atcgataaac + 30541 gagagcgtca cgaatctaca agagttagat ttagaagagg aggcacgata atctaatgca + 30601 agatacaatt caaatagaca ataaaacaat tggatggctg gttgtgcaaa gagggttcga + 30661 gataccctct tttaattttg ttactgaaaa agaaaacgta aaaggtagag cgggatctat + 30721 tgttaagaat cgttatttaa atgatatcga atttgattta ccattaatta ttcgaaacga + 30781 aaaattgtca ccaggtggag aaaaaacaca cgatgatata ttagaagcat tggtcaagtt + 30841 cttcaatatt aaagatttaa cacctaaaaa acttaaattc aaatctcaaa actggtattg + 30901 gtttgcatat tttgatggtc cattaaaatt accgaaaaac ccaagaggtt cagtgaagtt + 30961 cactataaaa gtagtgttaa cagatcctta taaatactcg gtaactggaa acaaaaacac + 31021 cgcgatttca gaccaagttt cagttgtaaa tagtgggact gctgacactc ctttaattgt + 31081 tgaagcccga gcaattaaac catctagtta ctttatgatc actaaaaatg atgaagatta + 31141 ttttatggtt ggtgatgatg aggtaaccaa agaagttaag gattacatgc ctcctgttta + 31201 tcatagtgag tttcgtgatt tcaaaggttg gactaagatg attactgaag atattccaag + 31261 taatgattta ggtggtaagg tcggcggtga ctttgtgata tccaatcttg gcgaaggata + 31321 taaagcaact aattttcctg atgcaaaagg ttgggttggt gctggcacga aacgagggct + 31381 ccctaaagcg atgacagatt ttcaaattac ctataaatgt attgttgaac aaaaaggtaa + 31441 aggtgccgga agaacagcac aacatattta tgatagtgat ggtaagttac ttgcttctat + 31501 tggttatgaa aataaatatc atgatagaaa aataggacat attgttgtta cgttgtataa + 31561 ccaaaaagga gaccccaaaa agatatacga ctatcagaat aaaccgataa tgtataactt + 31621 ggacagaatc gttgtttata tgcggctcag aagagtaggt aataaatttt ctattaaaac + 31681 ttggaaattt gatcacatta aagacccaga tagacgtaaa cctattgata tggatgagaa + 31741 agagtggata gatggcggta agttttatca gcgtccagct tctatcatag ctatctatag + 31801 tgcgaagtat aacggttata agtggatgga gatgaatgga ttaggttcat tcaatacgga + 31861 gattctaccg aaaccgaaag gcgcaaggga tgtcattata caaaaaggtg atttagtgaa + 31921 aatagatatg caagcaaaaa gtgttgtcat caatgaggaa ccaatgttga gcgagaaatc + 31981 gtttggaagt aattatttca atgttgattc tgggtacagt gaattaatca tacaacctga + 32041 aaacgtcttt gatacgacgg ttaaatggca agatagatat ttatagaaag gagatgagag + 32101 tgtgatacat gttttagatt ttaacgacaa gattatagat ttcctttcta ctgatgaccc + 32161 ttccttagtt agagcgattc ataaacgtaa tgttaatgac aattcagaaa tgcttgaact + 32221 gctcatatca tcagaaagag ctgaaaagtt ccgtgaacga catcgtgtta ttataaggga + 32281 ttcaaacaaa caatggcgtg aatttattat taactgggtt caagatacga tggacggcta + 32341 cacagagata gaatgtatag cgtcttatct tgctgatata acaacagcta aaccgtatgc + 32401 accaggcaaa tttgagaaaa agacaacttc agaagcattg aaagatgtgt tgagcgatac + 32461 aggttgggaa gtttctgaac aaaccgaata cgatggctta cgtactacgt catggacttc + 32521 ttatcaaact agatatgaag ttttaaagca attatgtaca acctataaaa tggcattgga + 32581 tttttatata gagcttagtt ctaataccgt caaaggtaga tatgtggtac tcaaaaagaa + 32641 aaacagctta ttcaaaggta aagaaattga gtatggtaaa gatttggttg ggttaactag + 32701 gaagattgat atgtcagaaa tcaaaacagc attaattgct gtgggacccg aaaatgacaa + 32761 aggaaagcgt ttagagttag ttgtgactga tgacgaagca caaagtcaat tcaacttacc + 32821 tacccgttat atttggggaa tatacgaacc tcaatcagat gatcaaaata tgaatgaaac + 32881 acggttgcgt tctttagcca aaacagagtt aaataaacgt aagtcggcag ttatgtcata + 32941 tgagattact tctactgatt tggaagttac gtatccgcac gagattatat caattggtga + 33001 tacagtcaga gtaaaacata gagattttaa cccgccattg tatgtagagg cagaagttat + 33061 tgccgaagaa tataacataa tttcagaaaa tagcacatat acattcggtc aacctaaaga + 33121 gttcaaagaa tcagaattac gagaagagtt taacaaacga ttgaacataa tacatcaaaa + 33181 gttaaacgat aatattagca atatcaacac tatagttaaa gatgttgtag atggtgaatt + 33241 agaatacttt gaacgcaaaa tacacaaaaa tgatacaccg ccagaaaatc cagtcaatga + 33301 tatgctttgg tatgatacaa gtaaccctga tgttgctgtc ttgcgtagat attggaatgg + 33361 tcgatggatt gaagcaacac caaatgatgt tgaaaaatta ggtggtataa caagagagaa + 33421 agcgctattc agtgaattaa acaatatttt tattaattta tctatacaac acgctagtct + 33481 tttgtcagaa gctacagaat tactgaatag cgagtactta gtagataatg atttgaaagc + 33541 ggacttacaa gcaagtttag acgctgtgat tgatgtttat aatcaaatta aaaataattt + 33601 agaatctatg acacccgaaa ctgcaacgat tggtcggttg gtagatacac aagctttatt + 33661 tcttgaatat agaaagaaat tacaagatgt ctatacagat gtagaagatg tcaaaatcgc + 33721 tatttcagat agatttaaat tattacagtc acaatacact gatgaaaaat ataaagaagc + 33781 gttggaaata atagcaacaa aatttggttt aacggtgaat gaagatttgc agttagtcgg + 33841 agaacctaat gttgttaaat cagctattga agcagctaga gaatccacaa aagaacaatt + 33901 acgtgactat gtaaaaacat cggactataa aacagacaaa gacggtattg ttgaacgttt + 33961 agatactgct gaagctgaga gaacgacttt aaaaggtgaa atcaaagata aagttacgtt + 34021 aaacgaatat cgaaacggat tggaagaaca aaaacaatat actgatgacc agttaagtga + 34081 tttgtccaat aatcctgaga ttaaagcaag tattgaacaa gcaaatcaag aagcgcaaga + 34141 agctttaaaa tcatacattg atgctcaaga taatcttaaa gagaaggaat cgcaagcgta + 34201 tgctgatggt aaaatttcgg aagaagagca acgcgctata caagatgctc aagctaaact + 34261 tgaagaggca aaacaaaacg cagaactaaa ggctagaaac gctgaaaaga aagctaatgc + 34321 ttatacagac aacaaggtca aagaaagcac agatgcacag aggagaacac tgactcgcta + 34381 tggttctcaa attatacaaa atggtaagga aatcaaatta agaactacta aagaagagtt + 34441 taatgcaacc aatcgtacac tttcaaatat attaaacgag attgtccaaa acgttacaga + 34501 tggaacaaca atcagatatg atgataacgg agtggctcaa gctttaaatg tggggccacg + 34561 tggtattaga ttaaatgctg ataaaattga tattaacggt aatagagaaa taaaccttct + 34621 tatccaaaat atgcgagata aagtagataa aaccgatatt gtcaacagcc ttaatttatc + 34681 aagagagggt cttgatatca atgttaatag aattggaatt aaaggcggta acaataacag + 34741 atatgttcaa atacagaatg attctattga actaggtggt attgtgcaac gaacttggaa + 34801 aggcaaacga tcaaccgatg atatattcac acgtcttaaa gatggacatc taaggtttag + 34861 aaataatacc gcaggcggtt cactttatat gtcacatttt ggtatttcaa catatattga + 34921 tggagaaggc gaagacggag gttcatccgg tactattcaa tggtgggata aaacttacag + 34981 tgatagcggt atgaatggca taacaatcaa ttcctatggt ggtgtcgttg cactaacgtc + 35041 agataataat cgggttgttc tggagtctta cgcttcatcg aatatcaaaa gcaaacaggc + 35101 accggtgtat ttatatccaa acacagacaa agtgcctgga ttaaaccgat ttgcattcac + 35161 gctgtctaat gcagataacg cttattcgag tgatggttat attatgtttg gttctgatga + 35221 gaactatgat tacggtgcgg gtatcaggtt ttctaaagaa agaaataaag gtcttgttca + 35281 aattgttaat ggacgatatg caacaggtgg agatacaaca atcgaagcag ggtatggcaa + 35341 atttaatatg ctgaaacgac gtgatggtaa taggtatatt catatacaga gtacagacct + 35401 actgtctgta ggttcagatg atgcaggaga taggatagct tctaactcaa tttatagacg + 35461 tacttattcg gccgcagcta atttgcatat tacttctgct ggcacaattg ggcgttcgac + 35521 atcagcgcgt aaatacaagt tatctatcga aaatcaatat aacgatagag atgaacaact + 35581 ggaacattca aaagctattc ttaacttacc tattagaacg tggtttgata aagctgagtc + 35641 tgaaatttta gctagagagc tgagagaaga tagaaaatta tcggaagaca cctataaact + 35701 tgatagatac gtaggtttga ttgctgaaga ggtggagaat ttaggattaa aagagtttgt + 35761 cacgtatgat gacaaaggag aaattgaagg tatagcgtat gatcgtctat ggattcatct + 35821 tatccctgtt atcaaagaac aacaactaag aatcaagaaa ttggaggagt caaagaatgc + 35881 aggataacaa acaaggatta caagctaatc ctgaatatac aattcattat ttatcacagg + 35941 aaattatgag gttaacacaa gaaaacgcga tgttaaaagc gtatatacaa gaaaataaag + 36001 aaaatcaaca atgtgctgag gaagagtaat ccttagcact atttttatac aaaaatttaa + 36061 ggaggtcatt taattatggc aaaagaaatt atcaacaata cagaaaggtt tattttagta + 36121 caaatcgaca aagaaggtac agaacgtgta gtatatcaag atttcacagg aagttttaca + 36181 acttctgaaa tggttaacca tgctcaagat tttaaatctg aagaaaacgc taagaaaatt + 36241 gcggagacgt taaatttgtt atatcaatta actaacaaaa aacaacgtgt gaaagtagtt + 36301 aaagaagtag ttgaaagatc agatttatct ccagaggtaa cagttaacac tgaaacagta + 36361 tgaaaagcta tgagttagat actcataatc tttattcttt tagaaagcgg gtgtactgaa + 36421 ttggggtggt tcaaaaaaca cgaacatgaa tggcgcatca gaaggttaga agagaatgat + 36481 aaaacaatgc tcagcacact caacgaaatt aaattaggtc aaaaaaccca agagcaagtt + 36541 aacattaaat tagataaaac cttagatgct attcaaaaag aaagagaaat agatgaaaag + 36601 aataagaaag aaaatgataa gaacatacgt gatatgaaaa tgtgggtgct tggtttagtt + 36661 gggacaatat ttgggtcgct aattatagca ttattgcgta tgcttatggg catataagag + 36721 aggtgaataa aatgtttaaa ctaatctttg gttatagttt ctggacatgt ttttggttcg + 36781 gtaaatgtaa ataagtttta gtcagtgctt cggtactgac tttttattta ttgttgtaat + 36841 tatggtaata tgcagaagtg agcaagttgg atagatggtg gctatctgag tataaggagg + 36901 tggtgcctat ggtggcatta ctgaaatctt tagaaaggag acgcctaatg attacaatta + 36961 gtaccatgtt gcagtttggt ttattcctta ttgcattgat aggtctagta atcaagctta + 37021 ttgaattaag caataaaaaa taaccatcgc taactttggc tggtttcgat ggttaaatgg + 37081 ttattaattt aatctttaat ctaaaatagc caccgtcttt ttaacgggct cattagggta + 37141 acatgtttgc gcatgttgcc ctttttctat atataaatta acacaccata atataaatat + 37201 caaatagacg gcttattagt cgtcttttta ttttgggtaa aaggagataa gaatatgatt + 37261 aattggaaaa ttagaatgaa acaaaaatca ttttgggtag cgatattgtc agctatcttt + 37321 ttatttgctc aaaacatcgc aaaagctatt gggtatgata tccaagttta tacagagcaa + 37381 ttaacagacg gtttaaacgc tatattagga tttttagtat taactggtgt gattcaagac + 37441 ccgactacta aaggtatagg tgatagccac caagctttag aatatgaaga accaagaaga + 37501 aaatactagg aggtaaaata atgaaaacat acagtgaagc aagagcaagg ttacgttggt + 37561 atcaaggtag atatattgat tttgacggtt ggtatggtta ccaatgtgca gatttagcag + 37621 ttgattacat ttattggttg ttagaaatta gaatgtgggg aaatgcaaaa gatgcaatca + 37681 ataacgattt taaaaacatg gcaacagtat atgaaaacac accatcgttt gttccacaaa + 37741 taggtgatgt ggctgtattt accaaaggaa tatataaaca atacggtcat attggtttag + 37801 tgtttaatgg tggtaataca aaccaatttt taattttgga acagaactat gacggtaacg + 37861 caaatacgcc tgcaaagtta cgttgggata attattacgg ctgtactcac tttattagac + 37921 ctaagtataa aagtgagggc ttaatgaata agatcacaaa taaagttaaa ccacctgctc + 37981 aaaaagcagt cggtaaatct gcaagtaaaa taacagttgg aagtaaagcg ccttataacc + 38041 ttaaatggtc aaaaggtgct tattttaatg cgaaaatcga cggcttaggt gctacttcag + 38101 ccactagata cggtgataat cgtactaact atagattcga tgttggacag gctgtatacg + 38161 cgcctggaac attaatatat gtgtttgaaa ttatagatgg ttggtgtcgc atttattgga + 38221 acaatcataa tgagtggata tggcatgaga gattgattgt gaaagaagtg ttttaattct + 38281 taggttaaaa tgttaaatat ttgttaatta ttttttaatg taagtttagt ttcttttaat + 38341 attttattga tttttaatat tttttcgata taaaatgaag ttgttgatat ttatcatctt + 38401 aaataagggt gttagctata aaaagagata aataaaaaca aatatattat atttggagga + 38461 agcgccatgc tcaaaagaag tttattattt ttaactgttt tattgttatt attctcattt + 38521 tcttcaatta ctaatgaggt aagtgcatca agttcattcg acaaaggaaa atataaaaaa + 38581 ggcgatgacg cgagttattt tgaaccaaca ggcccgtatt tgatggtaaa tgtgactgga + 38641 gttgatggta aaggaaatga attgctatcc cctcattatg tcgagtttcc tattaaacct + 38701 gggactacac ttacaaaaga aaaaattgaa tactatgtcg aatgggcatt agatgcgaca + 38761 gcatataaag agtttagagt agttgaatta gatccaagcg caaagatcga agtcacttat + 38821 tatgataaga ataagaaaaa agaagaaacg aagtctttcc ctataacaga aaaaggtttt + 38881 gttgtcccag atttatcaga gcatattaaa aaccctggat tcaacttaat tacaaaggtt + 38941 attatagaaa agaaataaaa caaaatagtt gtttattata gaaagcaatg tcttgattga + 39001 atatgtgtag tgaaaattat ctttcatcaa attctcattc atgcacgaat ggttcttccc + 39061 cacctaatca gatattaggt gacttatggg gagaaatcag ttaggatgaa aaagtggata + 39121 atcctttttt aggcaggtac ttcggtactt gcctattttt ttatgttata atctttctag + 39181 acgtattcaa gggacgtctt tttagattgt atgttatagc tagctttcgg gctagttttt + 39241 tgttatgatg tgttacacat gcatcaacta tttacatcta tccttgttca cccaagcatg + 39301 tcactgggtg ttttttctta tgatagagag catagttttc atactactcc ctcgtagtat + 39361 atatgacttt agcattcccg tataatagtt tacggggtgc tttttatgtt ataattaact + 39421 gtatatagta ggagtgaact atatagcctg ttaagtggcc tagtaaccta acacttatcc + 39481 tgcaattgat atcctttttg cccttcactc gatacatata tctcaacaac atagaaatat + 39541 tacagtcgct acaccgcatc ttaaatggtg tggttatttt tattggaagt gtgtatcagg + 39601 tatcagtaat gttaaaacac cagctaaaaa tgaaaagaat tcaccagtgc cagcaggtta + 39661 tacactcgat aaaaacaatg taccgtataa aaaagagact ggttattaca cagttgccaa + 39721 tgttaaaggt aataacgtga gggatggcta ttcaactaat tcaagaatta caggtgtatt + 39781 acccaataac gcaactatca aatatgacgg cgcatattgc attaatggct atagatggat + 39841 tacttatatt gctaatagtg gacaacgtcg ttatatagcg acaggagagg tagacaaggc + 39901 aggtaataga ataagcagtt ttggtaagtt tagtgcagtt tgataattag atatataaag + 39961 gtttggcaag ttatgaaatg tctgccaaac ctttatataa aaaagaaata tctacctttt + 40021 aatttatgta actactatta gtatgcatat tcattagttt ttccaggacc attaattaca + 40081 taagatgatt tagactctcc ttttttaaag aagtatgttt tatacatttt acctagtaac + 40141 tcaacatttt ttctatcttc agcaagtggt gtattcagat atactgtata gtaaccttta + 40201 ttttcagtta aaataaccat tttttcaaat tgagcagaat tttttgtgcc tttctttaaa + 40261 taatttctca aacgttcatc taattttcct agtgttgtag gaagaccact atttttaaat + 40321 gattctttat aagctttttc tttctctaac aatttcttat ttgattctat ttcttcattt + 40381 gtaggaaacg gttcaaaagt aaaagctttc gctgaatgat ggtgtgtact gattcctgcc + 40441 gttaaaaaac ttaatgctaa aactgttgtt gctaatttct ttttcataat gatgttaatt + 40501 ctccttaaat tctatattta aatttatagt tagttttgcg aaattcctaa aatgagttta + 40561 atctaatcga tgaaatatat taattaactg gaaattaata aaagattaat tatttttaac + 40621 tcaaaattaa agttcaatta gtgttttgat gaatttggtc ttgataaatt gaaatgatct + 40681 aaaaaacgct ataatttttc tattaatagt aattaatatg tgctatattt atcttagaca + 40741 cagcaatgtg ttcaaatttt catctattca taagctagcc ttcgggctag tttttttgtg + 40801 ctatatattt gttttaatta aataaaatta gataatgcaa tagtagccat tttatgttaa + 40861 tattaccttg ggcgttttca aggagcgcct ttcatttttt atgtattgct ccccttcggg + 40921 ctagtatatt aaatttattt ttgcgctttc caaatcaatg tatatgtgtt atattgttta + 40981 tgggaagtag gtaagcattt cggtgcttac ctttttttgt ttttctataa atacaataag + 41041 gtatgtcaat ttgataattt attaattttc atttaataag aagatctata tagttaatga + 41101 ataattaatg tacttttttt tagttagtca ttaaaataaa ttagtactaa ttactaagga + 41161 gaataaaaaa tgaaaattag aaaatctata cttgcgggaa ctttagcaat cgttttagca + 41221 tcaccactag taactaatct agataaaaat gaggcacaag ctagcacaag cttgccaaca + 41281 tcgaatgaat atcaaaacga aaagttagct aatgaattaa aatcgttatt agatgaacta + 41341 aatgttaatg aattagctac tggaagttta aacacttatt ataagcgaac tataaaaatt + 41401 tcaggtctaa aagcaatgta tgctcttaag tcaaaagact ttaagaaaat gtcagaagca + 41461 aaatatcaac ttcaaaagat ttataacgaa attgacgaag cactaaaaag taaatattaa + 41521 aaaaaccacc cttttacggg tggttttaat tttctagata atataaaagt gttcataaat + 41581 aaaacagtat aggcaaacaa taaagtattg aaaaaagtaa gtttaatatg aaaattgtta + 41641 aatgaacgac atcttttgtt tttataaata tcaagaaaat aatcaaactc aaaataaata + 41701 acgtaactgt agtcataggc gtccatacat aatcagcatt agtcattaag aatggtgcag + 41761 ccattatgaa aaaatttata atgcagatga aatagacaat tagactataa attaggtaaa + 41821 taacaataca cacccttcat aaataaataa tttaaatcct atatatttta acaaaagtaa + 41881 aacacagaag tgtagaaaat aaaaaatatt ggtaaataaa atcaataagt ttaaccaata + 41941 tgttgctcgc ttcataccgt atattgcaac aaaaattccg atcaagaaaa atatagcccc + 42001 tatgataaaa cagaaatccg atgctgaact attaaaaaat gaggtgttta gagttagaaa + 42061 atgagttaat gagttgacta taactaataa gatattaatt atatttgtat ggttcttcac + 42121 atgatacctc caagtaaaaa aatctaatta ataaagtgaa tgcttgatga acaagcagtt + 42181 attccaaaca gaatcaataa gaaaagtaga atcaacatgc taatgcccca taaacaaccc + 42241 ttttcacttt ctctattatt aatttcttga cttcttttta aagatttatt acttttacat + 42301 tctttagttg ttttaaattt cacgttttta ttacttcctt ttgtctaaaa gtttacaatg + 42361 aatttttgat tataataata tattcaaaat agtactatct agtttgatat gtcaagcaat + 42421 attattataa aattggaatt ctgagttgtc tactctaatt tattatattt acctataaaa + 42481 atacacctca aaaaatagat ttttcagtct agcttttggg gtgtacattc cacacaaaca + 42541 tgtgattatt ttgatgtttc tattaaactt gtaattttaa atttaaagtc cctaaaaagt + 42601 ccctaaaatt ttattttata tggggtatta ttgataatga taaagttata aaccttgata + 42661 ttatgctgtt ttactttttg aatgataagt aattttatgt taaaagtctc cagtttggat + 42721 ac +// diff --git a/tests/test_data/golden/rfam/pharokka.gff b/tests/test_data/golden/rfam/pharokka.gff new file mode 100644 index 0000000..da93b0e --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka.gff @@ -0,0 +1,803 @@ +##gff-version 3 +##sequence-region NC_004617.1 1 42722 +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 59 1096 -1224391000.0 - 0 ID=PHARTEST_CDS_0001;transl_table=11;phrog=1;locus_tag=PHARTEST_CDS_0001;function=integration and excision;product=integrase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 1087 1188 -0.7254348 + 0 ID=PHARTEST_CDS_0002;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0002;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 1204 1818 -336329.9 + 0 ID=PHARTEST_CDS_0003;transl_table=11;phrog=716;locus_tag=PHARTEST_CDS_0003;function=other;product=Na/K ATPase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 1815 1940 -6.788884 - 0 ID=PHARTEST_CDS_0004;transl_table=11;phrog=787;locus_tag=PHARTEST_CDS_0004;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 1997 2164 -3.693734 - 0 ID=PHARTEST_CDS_0005;transl_table=11;phrog=1176;locus_tag=PHARTEST_CDS_0005;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 2234 2323 -5.398136 - 0 ID=PHARTEST_CDS_0006;transl_table=11;phrog=17436;locus_tag=PHARTEST_CDS_0006;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 2378 3148 -5833512000.0 - 0 ID=PHARTEST_CDS_0007;transl_table=11;phrog=4;locus_tag=PHARTEST_CDS_0007;function=transcription regulation;product=transcriptional repressor +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 3130 3225 -0.261276 + 0 ID=PHARTEST_CDS_0008;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0008;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 3307 3531 -411.6681 + 0 ID=PHARTEST_CDS_0009;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0009;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 3549 3809 -3711.756 + 0 ID=PHARTEST_CDS_0010;transl_table=11;phrog=6175;locus_tag=PHARTEST_CDS_0010;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 3833 4372 -117442.9 - 0 ID=PHARTEST_CDS_0011;transl_table=11;phrog=10240;locus_tag=PHARTEST_CDS_0011;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 4429 5178 -64592260.0 + 0 ID=PHARTEST_CDS_0012;transl_table=11;phrog=63;locus_tag=PHARTEST_CDS_0012;function=transcription regulation;product=anti-repressor Ant +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 5194 5391 -562.1181 + 0 ID=PHARTEST_CDS_0013;transl_table=11;phrog=845;locus_tag=PHARTEST_CDS_0013;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 5422 5562 -226.453 + 0 ID=PHARTEST_CDS_0014;transl_table=11;phrog=1263;locus_tag=PHARTEST_CDS_0014;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 5577 6209 -369622.9 - 0 ID=PHARTEST_CDS_0015;transl_table=11;phrog=4768;locus_tag=PHARTEST_CDS_0015;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 6268 6588 -819.0921 + 0 ID=PHARTEST_CDS_0016;transl_table=11;phrog=823;locus_tag=PHARTEST_CDS_0016;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 6585 6746 -14.63112 + 0 ID=PHARTEST_CDS_0017;transl_table=11;phrog=369;locus_tag=PHARTEST_CDS_0017;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 6839 7099 -247.9693 + 0 ID=PHARTEST_CDS_0018;transl_table=11;phrog=401;locus_tag=PHARTEST_CDS_0018;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 7109 7330 -413.1051 + 0 ID=PHARTEST_CDS_0019;transl_table=11;phrog=946;locus_tag=PHARTEST_CDS_0019;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 7323 8102 -990899.9 + 0 ID=PHARTEST_CDS_0020;transl_table=11;phrog=124;locus_tag=PHARTEST_CDS_0020;function=DNA, RNA and nucleotide metabolism;product=Sak4-like ssDNA annealing protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 8133 8684 -1198907.0 + 0 ID=PHARTEST_CDS_0021;transl_table=11;phrog=378;locus_tag=PHARTEST_CDS_0021;function=DNA, RNA and nucleotide metabolism;product=single strand DNA binding protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 8697 9368 -302118.5 + 0 ID=PHARTEST_CDS_0022;transl_table=11;phrog=398;locus_tag=PHARTEST_CDS_0022;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 9365 9514 -207.6077 + 0 ID=PHARTEST_CDS_0023;transl_table=11;phrog=1902;locus_tag=PHARTEST_CDS_0023;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 9507 9788 -376.2408 - 0 ID=PHARTEST_CDS_0024;transl_table=11;phrog=1090;locus_tag=PHARTEST_CDS_0024;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 9764 10624 -26027360.0 + 0 ID=PHARTEST_CDS_0025;transl_table=11;phrog=428;locus_tag=PHARTEST_CDS_0025;function=DNA, RNA and nucleotide metabolism;product=replication initiation protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 10634 11413 -876131.3 + 0 ID=PHARTEST_CDS_0026;transl_table=11;phrog=50;locus_tag=PHARTEST_CDS_0026;function=DNA, RNA and nucleotide metabolism;product=DnaC-like helicase loader +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 11407 11565 -17.82607 + 0 ID=PHARTEST_CDS_0027;transl_table=11;phrog=809;locus_tag=PHARTEST_CDS_0027;function=transcription regulation;product=transcriptional regulator +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 11578 11799 -142.4595 + 0 ID=PHARTEST_CDS_0028;transl_table=11;phrog=433;locus_tag=PHARTEST_CDS_0028;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 11810 12214 -576.0835 + 0 ID=PHARTEST_CDS_0029;transl_table=11;phrog=190;locus_tag=PHARTEST_CDS_0029;function=DNA, RNA and nucleotide metabolism;product=Holliday junction resolvase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 12219 12404 -67.00934 + 0 ID=PHARTEST_CDS_0030;transl_table=11;phrog=299;locus_tag=PHARTEST_CDS_0030;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 12405 12776 -4011.613 + 0 ID=PHARTEST_CDS_0031;transl_table=11;phrog=201;locus_tag=PHARTEST_CDS_0031;function=DNA, RNA and nucleotide metabolism;product=Panton-Valentine leukocicin +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 12777 13025 -46.32995 + 0 ID=PHARTEST_CDS_0032;transl_table=11;phrog=258;locus_tag=PHARTEST_CDS_0032;function=other;product=virulence associated +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 13089 13436 -70910.01 + 0 ID=PHARTEST_CDS_0033;transl_table=11;phrog=24347;locus_tag=PHARTEST_CDS_0033;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 13433 13822 -22939.32 + 0 ID=PHARTEST_CDS_0034;transl_table=11;phrog=742;locus_tag=PHARTEST_CDS_0034;function=other;product=acetyltransferase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 13815 14069 -1762.447 + 0 ID=PHARTEST_CDS_0035;transl_table=11;phrog=4380;locus_tag=PHARTEST_CDS_0035;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 14056 14226 -600.1063 + 0 ID=PHARTEST_CDS_0036;transl_table=11;phrog=1235;locus_tag=PHARTEST_CDS_0036;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 14219 14755 -33454.96 + 0 ID=PHARTEST_CDS_0037;transl_table=11;phrog=173;locus_tag=PHARTEST_CDS_0037;function=DNA, RNA and nucleotide metabolism;product=nucleoside triphosphate pyrophosphohydrolase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 14792 14965 -75.45788 + 0 ID=PHARTEST_CDS_0038;transl_table=11;phrog=3521;locus_tag=PHARTEST_CDS_0038;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 14982 15188 -54.02398 + 0 ID=PHARTEST_CDS_0039;transl_table=11;phrog=278;locus_tag=PHARTEST_CDS_0039;function=transcription regulation;product=transcriptional regulator +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 15185 15334 -33.26004 + 0 ID=PHARTEST_CDS_0040;transl_table=11;phrog=152;locus_tag=PHARTEST_CDS_0040;function=transcription regulation;product=RinB-like transcriptional activator +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 15334 15534 -338.2886 + 0 ID=PHARTEST_CDS_0041;transl_table=11;phrog=386;locus_tag=PHARTEST_CDS_0041;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 15557 16027 -443.2011 + 0 ID=PHARTEST_CDS_0042;transl_table=11;phrog=1058;locus_tag=PHARTEST_CDS_0042;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 16142 16594 -32234.19 + 0 ID=PHARTEST_CDS_0043;transl_table=11;phrog=229;locus_tag=PHARTEST_CDS_0043;function=other;product=MazG-like pyrophosphatase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 16610 16954 -5902.167 + 0 ID=PHARTEST_CDS_0044;transl_table=11;phrog=144;locus_tag=PHARTEST_CDS_0044;function=DNA, RNA and nucleotide metabolism;product=HNH endonuclease +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 16985 17080 -1.419676 + 0 ID=PHARTEST_CDS_0045;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0045;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 17084 17551 -401471.4 + 0 ID=PHARTEST_CDS_0046;transl_table=11;phrog=83;locus_tag=PHARTEST_CDS_0046;function=head and packaging;product=terminase small subunit +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 17554 19248 -1.423703e+16 + 0 ID=PHARTEST_CDS_0047;transl_table=11;phrog=9;locus_tag=PHARTEST_CDS_0047;function=head and packaging;product=terminase large subunit +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 19393 20718 -3526820000000.0 + 0 ID=PHARTEST_CDS_0048;transl_table=11;phrog=12;locus_tag=PHARTEST_CDS_0048;function=head and packaging;product=portal protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 20711 21295 -718699.2 + 0 ID=PHARTEST_CDS_0049;transl_table=11;phrog=9644;locus_tag=PHARTEST_CDS_0049;function=head and packaging;product=head maturation protease +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 21383 22630 -1037907000000000.0 + 0 ID=PHARTEST_CDS_0050;transl_table=11;phrog=10;locus_tag=PHARTEST_CDS_0050;function=head and packaging;product=major head protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 22666 22824 -35.50524 + 0 ID=PHARTEST_CDS_0051;transl_table=11;phrog=933;locus_tag=PHARTEST_CDS_0051;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 22833 23165 -1015.769 + 0 ID=PHARTEST_CDS_0052;transl_table=11;phrog=40;locus_tag=PHARTEST_CDS_0052;function=connector;product=head-tail adaptor Ad1 +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 23152 23487 -125.4829 + 0 ID=PHARTEST_CDS_0053;transl_table=11;phrog=25;locus_tag=PHARTEST_CDS_0053;function=connector;product=head closure Hc1 +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 23487 23864 -45675.83 + 0 ID=PHARTEST_CDS_0054;transl_table=11;phrog=5;locus_tag=PHARTEST_CDS_0054;function=connector;product=tail completion or Neck1 protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 23861 24241 -621.686 + 0 ID=PHARTEST_CDS_0055;transl_table=11;phrog=78;locus_tag=PHARTEST_CDS_0055;function=connector;product=tail terminator +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 24242 25195 -68775320000.0 + 0 ID=PHARTEST_CDS_0056;transl_table=11;phrog=88;locus_tag=PHARTEST_CDS_0056;function=tail;product=major tail protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 25260 25706 -45214.34 + 0 ID=PHARTEST_CDS_0057;transl_table=11;phrog=187;locus_tag=PHARTEST_CDS_0057;function=connector;product=head-tail adaptor +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 25781 25888 -2.584621 + 0 ID=PHARTEST_CDS_0058;transl_table=11;phrog=15504;locus_tag=PHARTEST_CDS_0058;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 25944 30596 -1.857625e+36 + 0 ID=PHARTEST_CDS_0059;transl_table=11;phrog=4070;locus_tag=PHARTEST_CDS_0059;function=tail;product=tail length tape measure protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 30596 32086 -27602240000000.0 + 0 ID=PHARTEST_CDS_0060;transl_table=11;phrog=202;locus_tag=PHARTEST_CDS_0060;function=tail;product=distal tail protein Dit +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 32102 35887 -1.286733e+36 + 0 ID=PHARTEST_CDS_0061;transl_table=11;phrog=1786;locus_tag=PHARTEST_CDS_0061;function=head and packaging;product=minor head protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 35877 36029 -401.7119 + 0 ID=PHARTEST_CDS_0062;transl_table=11;phrog=1399;locus_tag=PHARTEST_CDS_0062;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 36076 36363 -35927.44 + 0 ID=PHARTEST_CDS_0063;transl_table=11;phrog=1747;locus_tag=PHARTEST_CDS_0063;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 36487 36717 -87.5808 + 0 ID=PHARTEST_CDS_0064;transl_table=11;phrog=276;locus_tag=PHARTEST_CDS_0064;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 36824 37033 -0.06822175 - 0 ID=PHARTEST_CDS_0065;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0065;function=unknown function;product=hypothetical protein +NC_004617.1 profile:Infernal:1.1.5 ncRNA 36836 37015 94.6 + . ID=PHARTEST_ncRNA_1;locus_tag=PHARTEST_ncRNA_1;product=Listeria sRNA rli28;Dbxref=RFAM:RF01492;ncRNA_class=ncRNA;note=rli28 +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 37096 37203 -0.5872936 - 0 ID=PHARTEST_CDS_0066;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0066;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 37255 37509 -1784.258 + 0 ID=PHARTEST_CDS_0067;transl_table=11;phrog=297;locus_tag=PHARTEST_CDS_0067;function=lysis;product=holin +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 37521 38276 -2998422.0 + 0 ID=PHARTEST_CDS_0068;transl_table=11;phrog=635;locus_tag=PHARTEST_CDS_0068;function=lysis;product=endolysin +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 38467 38958 -325788.2 + 0 ID=PHARTEST_CDS_0069;transl_table=11;phrog=4358;locus_tag=PHARTEST_CDS_0069;function=other;product=kinase +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39003 39104 -1.780166 + 0 ID=PHARTEST_CDS_0070;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0070;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39114 39248 -0.6784799 + 0 ID=PHARTEST_CDS_0071;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0071;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39248 39385 -1.277119 + 0 ID=PHARTEST_CDS_0072;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0072;function=unknown function;product=hypothetical protein +NC_004617.1 profile:Infernal:1.1.5 ncRNA 39255 39405 195.7 + . ID=PHARTEST_ncRNA_2;locus_tag=PHARTEST_ncRNA_2;product=Small pathogenicity island RNA X;Dbxref=RFAM:RF02672;ncRNA_class=ncRNA;note=SprX +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39486 39740 -0.4697653 + 0 ID=PHARTEST_CDS_0073;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0073;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39744 39878 -12.59126 + 0 ID=PHARTEST_CDS_0074;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0074;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 39940 40041 -0.216365 + 0 ID=PHARTEST_CDS_0075;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0075;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 40038 40487 -86531.41 - 0 ID=PHARTEST_CDS_0076;transl_table=11;phrog=7039;locus_tag=PHARTEST_CDS_0076;function=moron, auxiliary metabolic gene and host takeover;product=chemotaxis inhibition protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 40854 40994 -1.753655 + 0 ID=PHARTEST_CDS_0077;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0077;function=unknown function;product=hypothetical protein +NC_004617.1 profile:Infernal:1.1.5 ncRNA 40870 41011 170.4 + . ID=PHARTEST_ncRNA_3;locus_tag=PHARTEST_ncRNA_3;product=Small pathogenicity island RNA D;Dbxref=RFAM:RF01828;ncRNA_class=ncRNA;note=SprD +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 40966 41076 -0.7492102 + 0 ID=PHARTEST_CDS_0078;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0078;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 41170 41520 -21051.94 + 0 ID=PHARTEST_CDS_0079;transl_table=11;phrog=4954;locus_tag=PHARTEST_CDS_0079;function=other;product=complement inhibitor +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 41573 41764 -3.10709 - 0 ID=PHARTEST_CDS_0080;transl_table=11;phrog=20340;locus_tag=PHARTEST_CDS_0080;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 41812 42120 -5.785872 - 0 ID=PHARTEST_CDS_0081;transl_table=11;phrog=19469;locus_tag=PHARTEST_CDS_0081;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 42160 42270 -7.2915 + 0 ID=PHARTEST_CDS_0082;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0082;function=unknown function;product=hypothetical protein +NC_004617.1 ab initio prediction:PHANOTATE:1.6.7 CDS 42603 42722 -1.864639 - 0 ID=PHARTEST_CDS_0083;transl_table=11;phrog=No_PHROGs_HMM;locus_tag=PHARTEST_CDS_0083;function=unknown function;product=hypothetical protein +##FASTA +>NC_004617.1 +ATAGAAACCTTGTAACAACAGTATTTATTGGGTTTGGAGTCCCTAATGGGTCCCTAAATT +ACATACTTTCTAAAATTTTAGTTGTTTTTTTGTCCTCTTCATTAAATTTTTCTTCTAACA +AATGAGAATACACGGATGTAGTTATTGCTATATTTTTATGACCTAATCTTTTAGAAATGT +AATGTATAGATACACCTTTTGCTAGTAAATAAGAACAATGAGTGTGTCTTAATGCGTGCG +ATGTAATAATTGGTATATTATTGACTCTACAGGCTGATTTCAAAGCATTATTGATAGCCT +GAAGGTTAATTATAGATCCGGCTTCTTTGAAAATGTAACCATCATAGCTAATTGCAAATG +TACTTATGACGTCCATAATGTGTTTCATATCAGATTTAGCGATACTGATATATCTAGGGG +AAGTATCGGTTTTTCGCTCGTCAATAAATATAGTGTTTTTCACTTGGTTGATATGCTCAA +TCTTTATATTTCTTGCACCACTGACACGACAACCCGTACAAATCATTATGAATAGCGCTA +ATGATGAACGAGTTCTCTTCTTTCTGACGTGATCTTTTAGTATTTCATATTCAGTTACCG +AGATGAATTTTTCTTGTTCTGACTTCGTAGGTTTTCCGGCTTTATAATTAACTTTATAAG +CGGGGTTTTTAAAAATAAGTCCATCATATAATGCGTCATCTAAAGCTGACCGAATAGCAC +CGTTTGTTTTTCTTATAGTTTCTTTTGCGTGTTCTTTTGAATAGTCGTTTATGAATTTCT +GATAAACTTGTCTATTTATCTTTGATAACTCCATTTTACCTATTTTATGTTTTTGTATAT +GTTGTAATGCATTTCTATAATGACGGTAGGTATTTTCTTTAACAACAGGTTGTTTATATG +TTTTAATCCAATTTTCGAAGTATTCTGCAAGAGTTATATAGTTATCTATATTAAAACCAC +TTCTTAACTCATTTAACTTGTCTAGTCCAGCAGAATTAGCTTCACGCTTTGTTCTAAAAC +CTTTCTTACGGTATCTTTTTCCTTCATGCTTAAATTCATATTGCCATTTTTTACCATCGT +AACAACGTGTTTTCATGCGTTCCCTCCTCAAAATTGGCAAAAAATAATAAGGGTAGGCGG +GCTACCCAAAATTTAGTACTAGGTACTAAATATGTTATAATAAAATAAAAAGTAGGTGAT +AAGATGACTCAATTTCTAGGGGCGCTTCTTCTTACAGGAGTTTTAGGTTACATACCATAT +AAATATCTAACAATGATAGGTTTAGTTAGTGAAAAAAACAAGATTATCAATACTCCTGTA +TTATTGATTTTTTCTATTGAAACATGTTTGATATGGTTTTATACTTTTATAATTTTTAAT +AATGTTGATTTAAAAAATTTGAGTTTACTTCAGTTGCTTACAGGTCTAAAAGCAAATATT +TGGTTTCTAATTATTTTTGTTTTAACAGTGCTTGTATTTAATCCTTTAATTGTTAAATTC +ATTATCTGGTTAATTAATGAAACAAGAAAGTTTATGAATTTGGATTGTATAAGCTTATTA +GACAAAAGAGACAAGTTGTTTAATAACAACGGTAAACCAGTATTTATAGTTATTAAAGAC +TTTGAAAACAGAATCATTGAAGAGGGTGAACTTAAAACCTATAATTCAGCTGGTAGCGAT +TTCGATTTACTAGAGGTTGAGCGACAAGATTTCAAAGTATCTGATTTACCGTCAAACGAT +GAATTGTATATTAAACATACACTTGTAGACCTTAAACAACAAATTAAATTGGATTTATAT +TTAATGAATGAATATTAATCTTTTTTCTTAGCTTTTTCTGATAAAGTGCTTTTTAAGTTT +TCGCTGGCACCCGGCTTTTCAAAACTTTTGTTTATTGGGTTACTACGAGTAGCTTCTTGT +TTTTTGTTTTTATCCGCCATAAAATTCTCACCACCATTCAACGTCTACACTTGTAGGCGT +TTTTTGTTTAGTAAAATCATAATGAATCTTCTTTGGTTAACTTATCGCCATCTAATTTTT +GTGAAATAAATTCCAAGTATTTACGCGCATTATGTGACGATAAATCTTTAGGTAACTCAT +AAGTGAATGGTTGATTACCACTAGTTAAAACTTCATATACTATAGTTTCTTTTTTATTTT +GCAATTAGTTATTTTCATTATAAACTTCCTTTCAAACACTGCTGAAATAGACGTCTTTTT +CAAATAAGCATGATTAATACTTCAATTCTTTAATCCACATATATTTAAAAGTGAGGTAGT +AGGTAATAAATATAAGACTTAAAGTTAAGATTGCTTTTTTCATGTCAATTTCTCCTTTGT +TTATATTTATATTAAAGCGCTAAATATACGTTATTAATCACAATACAACTTTGCCCATTA +CTTTAATATCACTAAACGAAGCGACTTTGATATCATCATACTTCGGATTTAGAGATACCA +AATTAATATAGTCTTCGCATATATCTACACGCTTGATAAGACTTACTCCATCTAATACAA +CGAGTGCAATTGTACCATCTTTAATAGAATCTTCTTTCTTAATAAAAGCGTATGTTCCTT +GTTTTAACATAGGTTCCATTGAATCACCATTAACTAAAATACAAAAATCAGCATTTGATG +GCGTTTCGTCTTCTTTAAAAAATACTTCTTCATGCAATATGTCATCATATAATTCTTCTC +CTATGCCAGCACCAGTTGCACCACATGCAATATACGATACTAGTTTAGACTCTTTATATC +CATCTATAGAAGTGACTTTATTCTGTTCTTCCAATTGTTCATTTGCATAGTTAAGTACGT +TTTCTTGGCGGGGAGGTGTGAGTTGAGAAAATATGTTATTGATTTTTGACATTATCGTTT +CATCTTGACGTTCTTCATCAGGAACTCGATAAGAATCTACATCATACCCCATAAGCCACG +CTTCACCAACGTTCAGAGTTTTAGAAAGTAGGTAAATTCTATCTTGGTCGGGTGATTGTA +CGTCGTTAATATATTGAGATAAAGTGCTTTTACTTAAAGATATACCTAGTTTCTTTTGAT +AAGGTTTCGATTTATTAATGATATCTACTTGTTTTAAGTTTCTTATTTTCATAATGTGTT +TAAGTCTATTTGAAACTTTTTCTCTCATTTAGTGCACCTCCGTTTGATAACTTCATAATA +AAGCTTGTTGAACAAAAATTCAACAAAAAAGTTCATAAATCATGAATTTTTGTATTGACT +TGATTCAAAACAAGGTGTAAAGTATAGTTAAGTTCATGATACGTGAACTTGAGAGGAGGT +GCTTTTATGTGTTACGACTACTCACGTTTGAGCGGGAAAATAGTAGAAAAGTATGGCACT +CAGTACAATTTTGCAATTGCTATGAAATTGTCAGAGAGAAGTTTATCCTTAAAACTCAAC +GGTAAAGTTGGTTGGAAAGACAGTGAAATATGGAAAGCTATACAACTACTAGATATACCG +GTAGAGAAAATACACTTATATTTTTTTAAAGAAAAAGTTCATGTTATATGAACTTAAGGA +GGGGCACAATGGAACAAATCACGTTAACCAAAGAAGAGTGTGTCGAACAATGCATCAATA +AAGACTTAAAACTTTTAGATTATCGAGTTCAACAAATTTTAGAAGGTGTTCTATCAGAAA +GTACCACATACGGTGATGCAAGAAATAAATTAGAAACATTGAAAATTATTGCTGAATCTC +ATTTTAAAACCGAACATGCTTCAGTTATTTACAAATTAGCATTGAAAAAGTTAGACGAAA +AAATCAACGCCACTCCAATTAAAGAGTGACGGAAAGGGAGGATTTTAAATGTTTAAGGTT +TTAAATGATATAAAAACTTCTTTAAAAAACCATCCTTGGGGTTGGAAAGAGCACTTACCT +TATTTGCTGATGTTAACTCTGTCACTTGTGGCTCTGATTCTCGGTGTTCTGTCCGCGATT +CTATGATAACAGGCTTTATATAGATTCCTTTGTTGGTAGTGACTTTGATAGTCACATCCC +ATTCCCATATCACTGGATATTCTTCGAGCAAAAAAGTACATTCTACACTTTCATAAGGTC +CTAAAGTAAATGGAATGGAGTAGTTTTTATCTTTATATCGTATAGGTTTGAACGTTTTTT +GTTCATTTACTTTATTTTTAATATCAAATTCAACGTCAATAACAGAAATGGGAAACTTTG +TGAAATTAATAAATGTTATATCGTTGTAACTTGATTTGTCATCGACCAAGTAATTAAAGC +TTCTGGTAGGTATAACATCGATGTTAATAGAATCTTTCATATAGTCTAAATAATATTTAA +GTGCAGTCAGTAAGAAACTAAAAATTGCGATACAAATCGCGATTATGTCCATACTTATCA +CCTCCTTAGGTTGATAACAACATTATACACGAAAGGAGCATAAACAATATGCAAGCATTA +AAAACAAAATCGAACATCGGCGAAATGTTCAACATACAAGAAAAAGAAAATGGAGAAATC +GCAATAAGTGCAAGAGAGTTATATAAAGCTTTGGAAGTTAAAAAGCGTTTTAGCGCTTGG +GCAGAAATTAACTTGAAGCATTTCAAAGAAAATAGGGATTTTACAAGTGTACTTACAAGT +ACGGTTGTTAATAACGGAGCTGTAAGACAACTAGAAGATTATGCTTTAACACTTGATGTA +GCTAAACATGTTGCGATGATGTCAGGTACAGAAAAAGGTTTTGATTTTAGAGAGTATTTC +ATCCAAGTAGAGAAAGCATGGAACAGTCCAGAAATGATTATGAAACGTGCTTTAAAAATT +GCTAACAACACAATCAATCAATTAGAAACAAAGATTGAACGTGATAAACCAAAAATTGTA +TTTGCAGATGCAGTAGCTACTACTAAGACATCAATTTTAGTTGGAGAGTTAGCAAAGATC +ATTAAACAAAACGGTATAAACATCGGGCAACGCAGATTGTTTGAGTGGTTACGTCAAAAC +GGATTCCTTATTAAACGCAAGGGTGTGGATTATAACATGCCTACACAGTATTCAATGGAA +CGTGAGTTATTCGAAATTAAAGAAACATCAATCACACATTCGGACGGTCATACATCAATT +AGTAAGACGCCAAAAGTAACAGGCAAAGGACAACAATACTTTGTTAATAAGTTTTTAGGA +GAAAAACAAACATCTTAATAGGAGGAACGAACAATGCAAGCTCAAAACAAAAAAGTCATT +TATTACTACTATGACGAAGCCGGTAATAGACGACCCGTTAATATTCAATACAACGATGGC +TACGACTTAATGATAGACCCGCGTTTTATTGAAATGACGCTTGAAAGACATCCGCATTTA +AAAAATAACTTTTATGGATTAATAGATGGAAAAGAATTTAAGTTAGATTAAATTTTTGGA +AATGCAAAGGAGGCATAACAAATGTTACAAAAATTTAGAATCGCGAAAGAAAAAAATAAA +TTAAAACTCAAATTACTAAAGCATGCTAGTTACTGTTTAGAAAGAAGTAACAACCCTGAA +TTGTTGCGAGCAGTTGCAGAGTTGTTAAAGAAGGTTAACTAAATTAGGCCTTATTATTAC +TTTTTAGAATGTGAACAATAGGTCGATAAAAAACTTAATAAACAAACTATAGCAACTATC +AATGAATTTTGAATATGTAAATCGTTCTCGTTTATATAGTTTGTTACAAAGATTTGAATG +TCAGCACCTGCTGCAATGCCATTAGACCATCTTATTAACTTTTTGAAAGGATGTGGAAAA +TCATTTTCGATACGTTTGACAAATTCATCGTGTCTCTTGTAGGTACTTTGCTCATTTATT +GGATAGGTCGAATTGATGGCTTCAGCCAAAGTAGAGATAGCAGTTGGATTGATATAAAAA +TCTCTAATGGTCTGTTGTGCTTGAAGTACAATCTCATCATCAAACCTATAGAGTTCCTTA +AAAGATTTTATCGTTTCTTCAGAAAATAAATTTCTTTGAAATGTTAGAGATGAAAAAGAA +TTACGCAAATTAAAATTCATTTCAATTAAGTTGTTTAGATGAAAGTCTACTTTGAAGTCA +GAAAATAAATTTATGTTGTTTCTATTAATTATATCTAATTGGTACTTAGGTTTTAAAGAT +TGTTTAATTGCCATACTTTTAGAAATTTCAACATTACTAATTACGTTATTAATAGAAAAA +CGAACATTTTTTAAAGGATCAATATACACCAATATCACCTCCTTTCACTAGGAGATAACA +ACATTATACACGAAAGGAAAGATAGAAATGCCACATATTTTAAACGTAACAGTTCCAATA +CCTGAAACACATGTACTTATCACAAAAGATGAATATGATGAGCTAATTGGTTATTCATTA +GACCCTGTATGGAACATGAGTGACTTAAAGAAGAAATTAAAAATTGCATCTGATGAGACT +ATCAAGGACAGATTACTATTTCATCCTAGATTTGAAAAAGAACTAAGAGCGCAAGGAATT +GTGCATTACCCAGATGAGAATTTTAATCGCTGGAGATTTAACGCAAGAAAGATGAATAAA +TTCGTCGATGAGCATTTCAATGAAATATATAAGGAGAGAATAAAATGAGCAACATTTATA +AAAGCTACCTAGTAGCAGTACTGTGCTTTACAGTCTTAGCAATTGTACTTATGCCGTTTC +TATACTTCACTACTGCATGGTCGATTGCGGGATTCGCAAGTATCGCAACATTCATATTTT +ATAAGGAATACTTTTATGAAGAATAAAAAAACTGTTACTCACGGCAATGAGTAACAGTCT +AAACAATTAGAAAATTAATGCATATTCAATATAAAACGAAATAAAGGAAGTGTCAACAAT +GTACTACAAAATTGGCGATGTATGTCAAAAAGTAATTAATGTAGACGGATTCGATTTTAA +ATTAGCAGTTAAGAAACAAGATTACAGCATTCTAGTGAATGTCTTAGATTTAGAAGATAG +ATTTATCGACGGTATAAATATAACAGATGAGAATGATCTATACACAGCATTAGACATATT +AAATCAATCTATTTATGAATGGATTGAAGAGAACACAGACGAAAGAGACAGGCTAATTAA +CTTAGTCATGAGATGGTAGGAGGTTGCTATGAAGCAGACTGTAACTTATCTAATCAAGCA +TAAAGATGAAAATCTATTTATTACAAACCGACCAACTGAAGTGAACGACACAGTGAAGTA +TTCAACTGATATGCGAGACGCAAGAGAATTCGACGGACTAGACAAAACCGTTATTGATAT +GTCTAAGCACAAAGCTATTAAGAAAACAGTGACAGAAACAATTGAGTACGAGAAGGTAGA +ACATGACTGAAAAAACTAATCAAGATGTCGATATCTTAACGCAACTAGGTGTAAAAGACA +TCAGCAAACAAAATGCAAACAAGTTTTATAAATTTGCGATATACGGCAAGTTCGGGACTG +GTAAAACTACGTTTTTAACAAAAGATAACAACGCCTTAGTACTAGATATAAATGAGGACG +GAACAACGGTAACAGAAGATGGGGCAGTTGTGCAGATTAAGAATTACAAGCATTTTAGTG +CAGTGATTAAGATGTTACCTAAAATTATTGAACAACTCAGAGAAAACGGAAAACAAATTG +ATGTTGTAGTGATTGAAACAATCCAAAAGCTACGTGATATCACTATGGACGACATCATGG +ACGGAAAATTAAAGAAACCAACATTTAATGATTGGGGCGAGTGTGCTACACGCATTGTAA +GTATTTATCGTTATATTTCTAAATTACAAGAACATTATCAATTCCATCTTGCTATAAGTG +GACACGAGGGAATTAACAAAGACAAAGATGATGAGGGTAGCACTATCAATCCAACAATCA +CGATAGAGGCACAAGATCAAATAAAAAAAGCGGTCATCAGTCAATCTGATGTGTTAGCAA +GAATGACAATAGAAGAACATGAGCAAGACGGCGAAAAAGCTTATCAATATGTTCTTAACG +CTGAACCATCAAACTTATTCGAGACAAAGATAAGACACTCAAGCAACATTAAAATTAACA +ACAAACGTTTCATTAATCCAAGTATTAACGACGTAGTACAAGCAATCAGAAATGGAAACT +AATAAAAAAACTAAAAAGGACGGTATTTAATTATGAAAATCACAGGACAAGCGCAATTTA +CTAAAGAAACAAATCAAGAAAAGTTTTATAACGGCTCAGCAGGGTTTCAAGCTGGAGAAT +TCACAGTGAAAGTTAAAAATATTGAATTCAATGATAGAGAAAATAGATATTTCACAATCG +TATTTGAAAATGATGAAGGCAAACAATATAAACATAATCAATTTGTACCGCCGTATAAAT +ATGATTTCCAAGAAAAACAATTGATTGAATTAGTTACTCGATTAGGTATTAAGTTAAATC +TTCCTAGCTTAGATTTTGATACCAATGATCTTATTGGTAAGTTTTGTCACTTGGTATTGA +AATGGAAATTCAATGAAGATGAAGGTAAGTATTTTACGGATTTTTCATTTATTAAACCTT +ACAAAAAGGGCGATGATGTTGTTAACAAACCTATTCCGAAGACAGATAAGCAAAAAGCTG +AAGAAAATAACGGGGCACAACAACAAACATCAATGTCTCAACAAAGCAATCCATTTGAAA +GCAGTGGCCAATTTGGATATGACGACCAAGATTTAGCGTTTTAAGGTGTGGTTTAAATGC +AATACATTACAAGATACCAGAAAGACAATGACGGCACTTATTCCGTCGTTGCTACTGGTG +TTGAACTTGAACAAAGTCACATTGACTTACTAGAAAACGGATATCCACTAAAAGCAGAAG +TAGAGGTTCCGGATAATAAAAAACTATCTATAGAACAACGCAAAAAAATATTCGCAATGT +GTAGAGATATAGAACTTCACTGGGGAGAACCGGTGGAATCAATTAGAAAATTATTACAAA +CAGAATTGGAAATTATGAAAGGTTATGAAGAAATCAGTCTGCGCGACTGTTCTATGAAAG +TTGCAAGGGAGTTAATAGAACTGATTATAGCGTTTATGTTTCATCATCAAATACCTATGA +GCATAGAAACAAGCAAGTTGTTAAGTGAAGATAAAGCACTATTGTATTGGGCTACAATCA +ACCGCAACTGTGTAATTTGTGGAAAGCCTCACGCAGACCTAGCGCATTATGAAGCAGTCG +GCAGAGGAATGAACAGAAACAAAATGAATCACTACAACAAACATGTATTAGCGTTATGTC +GCGAACACCATAACCAGCAACATGCGATTGGCGTTAAGTCGTTTGATGATAAATATCACT +TGCATGACTCGTGGATAAAAGTTGATGAGAGGCTCAATAAAATGCTGAAAGGAGAGAAAA +AGGAATGAATAGACTAAGAATAATAAAAATAGCACTCCTAATCGTCATCTTGGCGGAAGA +GATTAGAAGCGCTAAAAAAATTAAAAAATTTACCCCTGAGGATTCTAAAGGTTTTCCTGA +TATAACAAAAGATTCAATAAAAGAACCTAAATAAAAATATTATGGTTGATAAAATCCCAT +TGTTCTTTTGTTAACCACCCTTGTTTGTTATTGACTATTTCTGTAACAAACAGCTTATCT +CCAGAATCGAGATAAGGTTTCAACTTTTCTATCATTTCTGAAGTTGATAAAGAAGAACGG +AATAAAAATGAAGATTTCCAATAATTGCAATGACCATTAGAAATTTCCTTTTTTATAACA +TTTCTCAATTCCTCATATTTTTGTCCGGGTGAGTTTAAATCATATGTTAACATATAAGGT +TTTTCCATATTTTATTCACCCCCAATCTAACGCAGTAGCGATAACAAAATTATACCAGAA +AGGAGATAACGAAATGGCAACATTTAGAGTTTACAAAGAATCAGGTAACTTTGTCACAGT +ACACAAAGATTTTATACATGATTCTAATATAAGTTGGAAGGCTAAAGGTATTCTACTTTA +TTTGTTAAGTCGACCTGATAACTGGCAAATTTACGAAACAGAACTAGAGCAACATTCAAC +TGATGGACTTAGCGGTTTAAAGAGTGGAATCAAGGAACTGGAAGAAATTGGATACATTCA +ACGTAGTAGAAAACGTGATAAAAGTGGTAGGTTAAATGGTTATGAGTACTTAGTATATGA +GCAACCGCACCACATTCGATTTTCCAACGTTGGAAAAACCGTTAACGGTAAAACCAACAA +TGGAAAAACCGTTAATGGTAAATCGCATACTACTAATAATAATAGTACTAATAATGATTT +AACTAATAATAACAATACTAATAATGAAGGAAGTATATTGTCGGGCAACCCGACGGTGTC +TTCCATTCCCTATAAAGAAATTATCGAATACTTAAATAAAAAAGCAGGAAAGCATTTTAA +ACATAATACAGCTAAAACAAAAGATTTTATTAAAGCAAGATGGAATCAAGATTTTAGGTT +GGAGGATTTTAAAAAGGTGATTGATATCAAAACAGCTGAATGGTTAAACACGGATAGCGA +TAAATACCTTAGACCAGAAACACTTTTTGGCAGTAAATTTGAGGGGTACCTCAATCAAAA +AATACAACCAACTGGCACGGATCAATTGGAACGCATGAAGTACGACGAAAGTTATTGGGA +TTAGGGGGATATTATGAAACCACTATTCAGCGAAAAGATAAACGAAAGCTTGAAAAAATA +TCAACCTACTCATGTCGAAAAAGGATTGAAATGTGAGAGATGTGGAAGTGAATACGACTT +ATATAAGTTTGCTCCTACTAAAAAACACCCGAATGGTTACGAGTATAAAGACGGTTGCAA +ATGTGAAATCTATGAGGAATATAAGCGAAACAAGCAACGGAAGATAAACAACATATTCAA +TCAATCAAACGTTAATCCGTCTTTAAGAGATGCAACAGTCAAAAACTACAAGCCACAAAA +TGAAAAACAAGTACACGCTAAACAAACAGCAATAGAGTACGTACAAGGCTTCTCTACAAA +AGAACCAAAATCATTAATATTGCAAGGTTCATACGGAACTGGTAAAAGCCACCTAGCATA +CGCTATCGCAAAAGCAGTCAAAGCTAAAGGGCATACGGTTGCTTTTATGCACATACCAAT +GTTGATGGATCGTATCAAAGCGACATACAACAAAAATGCAGTAGAGACTACAGACGAGTT +AGTCAGATTGTTAAGCGATATTGATTTACTTGTACTAGATGATATGGGTGTAGAGAACAC +AGAACATACTTTAAACAAACTTTTCAGCATTGTTGATAACAGAGTAGGTAAAAACAACAT +CTTTACAACTAACTTTAGTGATAAAGAACTAAATCAAAATATGAACTGGCAACGTATCAA +TTCAAGAATGAAACACAATGCAAGAAAAGTAAGAGTAATCGGAGACGATTTCAGGGAGCG +AGACGCATGGTAACCAAAGAATTTTTGAAAATTAAACTTGAGTGTTCAGATATGTACGCT +CAGAAACTCATAGACGAGGCACAGGGCGATGAAAATAAGTTATATGACCTATTTATCCAA +AAACTTGCAGAACGTCACACACGCCCCGCTGTCGTCGAATATTAAGGAGTGTTAAAAATG +CCGAAAGAAAAATATTACTTATACCGAGAAGATGGCACGGAAGATATTAAGGTCATCAAG +TATAAAGACAACGTAAATGAAGTTTATTCTCTCACAGGAGCCCATTTCAGCGACGAAAAG +AAAATCATGACTGATAGAGACCTAAAACGATTCAAAGGCGCTCACGGGCTTCTATATGAG +CAAGAGCTAGGATTACAAGCAACGATATTTGATATTTAGAGGTGGCACAATGAGTAAATA +CAACGCTAAGAAAGTTGAGTACAAAGGAATTGTATTTGATAGCAAAGTAGAGTGCGAATA +TTACCAATATTTAGAAAGTAATATGAATGGCACTAACTATGATCGTATCGAACTACAACC +TAAATTCGAACTACAACCTAAATTTGGGAAGCAAAGACCGATTACGTATATAGCCGATTT +CTCTTTGTGGAAGGAAGGGAAACTGGTTGAAGTTATAGACGTTAAAGGTAAGGCGACTGA +AGTTGCCAACATCAAAGCGAAGATATTCAGATATCAGTATAGAGATGTGAATTTAACGTG +GATATGTAAAGCGCCTAAATACACAGGTCAAGAATGGATGGTATATGAGGACTTAGTGAA +AGTCAGACGTAAAAGAAAAAGAGAAATGAAGTGATTTAATGCAACAACAAGCATATATAA +ATGCAACGATTGATATAAGAATACCTACAGAAGTTGAATATCATCATTTCGATGATGTGG +ATGATGAAAAAGATATGCTAGCAAAGCGCTTAGATGACAATCCGGATGAATTACTAAAGT +ATGACAACATAACAATAAGACATGCATATATAGAGGTGGAATAAATGGCGAAAGCAGCAA +GAATTGTAAGGATACACGATAAACCTTATAGGTTCAGTAAATTTGAAATGGAATTAATAG +AAAGTCACGGTATAACCGCTGGAATGGTTTCTAAGAGAGTAAAAGACGGTTGGGAACTAC +ATGAAGCAATGGACGCACCAGAAGGTACGCGTTTAAGCGAGTACAGAGAAAAGAAAACAA +TAGAAAGACTGGAACAAGCTAGACTCGAACGCAAATTGGAAAGAAAGCGAAAGAGAGAGG +CTGAGCTAAGAAGAAAGAAGCCACACTTGTTTAATGTACCTCAGAAACATTCACGTGATC +CGTACTGGTTTGATAATACTTATAACCAAATGTTCAAGAAGTGGCAGGAAGTATAAATGC +CTAAAACCGATAGCGCATGTAAAGAATACTTAAACCAATTTTTCGGCTCTAAGAGATATT +TGTATCAGGATAACGAACGAGTGGCACATATCCATGTAGTGAATGGCACTTATTACTTTC +ACGGGCATATCGTACCAGGCTGGCAAGGCGTGAAAAAGACATTTGATACAACCGAAGAGC +TCGAAACATATATAAAGCAACATGGTTTGGAATACGAGGAACAGAAGCAACTAACTTTAT +TTTAAGGAGATGGAAATAATGAAAATCAAAACTGCAAGCATAGAGGTCGAAAAAGTGGAG +GTAGTAGTATGATGCCGAAATTTAGAGCGTGGGATAAAGATAAAAAAGTTATGAGTTTTA +TTGACGAAATCGATTTTAATAGTGGGTACATTTTGATTTCAACAGGTTATAAAAGTTTCA +ATGAAGTAAAACTATTACAATACACAGGATTTAAAGATGTGCACGGTGTGGAGATTTATG +AGGGGGATATTGTTCAAGATTCTTATTCCGGAGAAGTAAGTTTTATCGAGTTTAAAGAAG +GAGCCTTTTATATAACTTTTAGCAATGTAACTGAATTAATAAGTGAAAATGACGATATTA +TTGAAATTATTGGAAATATTTTTGAAAATGAGGAGCTATTGGAGGTTATGAGATGACGGT +CACCTTATCAGATGAACAATATAAAAACCTTTGTACTAAATTAAACAAGTTATTAGGTAA +ATTTCACAAAGCATTAAAAGAACGTGATGAGTACAAGAAGCAACAAGATGAGCTTATCGT +GGATATAGGTAAGTTAAGAGAACGTAACAAAGAGTTGGAGAACATGTGGCGCACTCTTAA +AAATGAATTGCTTGGAAGATACGAACATTACTGTTTTAAATTTAGAGAACTACACCCTGA +GAGCAAAGCGAACAGGATAGGAGCTCTCTATATAGGAGGTAAAAGCACTGCAGATATTAT +AATGTCGCGAATGGAAGAACTAGACGGAACAAATGAGTTCTACGAATTTTTAGGGCAAAT +GGAGGAAGACACAAATGAATAACCGTGAACAAATAGAACAATCCGTTATAAGTGCTAGTG +CGTATAACGGCAATGACACAGAGGGATTACTAAAAGAGATTGAGGACGTATATAAGAAAG +CGCAAGCGTTTGATGAAATACTTGAGGGAATGACAAATGCTATTCAACATTCAGTTAAAG +AAGGTATTGAACTTGATGAAGCAATAGGGATTATGGTAAGTCAAGTTATCTATGAATACA +AGGAGGAACTGGAGAATGAAAAAATTTAATGTTCAAATCACATATACAGGCATGATTGAA +GAGGCTATCGAGGCTGAAAGTTTAGAAGAAGCAGAATTTGAGGCTCATGATATTGCGAGA +ATGGAAGTGCCATTTGATTGTGATGAATTTGAAATTAATGTAGAGGTGGAACAGGAAAAT +GAATAACACATTAACAATTGATCAATTACAAGAGTTATTACAAATACAAAAAGAGTTCGA +CGATAGAATACCGACGCTGAACTTACGAGATAGCAAGATTGCATATGTAGTTGAATTCTT +TGAATGGTTTAATACATTGGAAACGTTTAAGAACTGGAAGAAGAAACCAGGTAAGCCGTT +AGACGTACAACTTGATGAATTAGCTGACATGTTGGCGTTTGGGTTGAGTATTGCGAATCA +AGTAGGAGTGTCATCAGAAGAGATAAAAGAAGCGATTGAATCAAGTTTTAAAAATACAGA +ATTTCACAAAATGTTTAATTTTAAAGATAAAGAATTTGCTCAAGACGCAGTTGTTAGTAC +ACCACAGATAATATTCAAAGAATTTTATCCCGACCAATTGGCAATTGTAATAGTGATAGA +CATAGCTTACAACTTATATTCTATCGACCAACTCATTGACGCATACAAAAAGAAAATGAA +AAGGAACCACGAAAGACAAGATGGAACAGCAGACGCAGGAAAAGGATACGTGTAAAGACA +TCTTAGATCGAGTTAAGGAGGTTTTGGGGAAGTGAGAGAACGCACTAAAATTATATATCG +TGGTTGGAACAAGGAGATATTTATTTTACAGGGTAAAAATATGAATGTTATTGGTTTGCG +CCAAATATTTGATGAACTCAAAAGATTGTACGAAGGTTATAAAATCGTTGTTATTCCAAT +AGAAGTTGATTTTGAAATCAAATAAATAGGAGTGATGAGAAGTGACACAATACTTAGTCA +CAACATTCAAAGATTCATCAGGACTACCACATGAACATTTTACTGCTGCTAGAGATAATC +AGACGTTTACAGTTGTTGAGGCGGAGAGTAAAGAAGAAGCGAAAGAGAAGTACGAGGCAC +AAGTTAAAAGGGATGCAGTTATTAAATTAGGTCAGTTGTTTGAAAATATAAGGGAGTGTG +GGAAATGATTAAGCAAATATTAAGATTATTATTCTTACTAGCGATGTATGAGCTAGGTAA +GTATGTAACTGAGCAAGTATATATTATGATGACAGCTAATGATGATGTAGAGGCGCCGAG +TGATTACGTCTTTCGAGCGGAGGTAAGTGAGTGATGTGGATTACTATGACTATTGTATTT +GCTATATTGCTATTAGTTTGTATCAGTATTAATAGTGATCGTGCAAGAGAGATACAAGCA +CTCAGATATATGAATGATTATCTACTTGATGAAGTAGTTAAAACTAAAGGATACAACGGG +TTAGAAGAATACAGGATTGAATTGAAGCGAATAAATAACGATATTAAAAAGTAATTTATA +TTATCGGAGGTATTGCATGTATAACAGGAAAGAAATACGTGAAATGATAGATAACTACAA +GTGGATGAAGAACATAATAGACAGTAAAGTCTACGATAACGAAAGTACATCAATTGCACA +ATATGGTTATCAATCTGCGATGCCAAAAGCTAAAGGCACGACTAGCAATAAAGTGTTAGT +GAAAGTTATAAACAAAAACAAAGCGCTTAGAAAGTACGATTACTTGATTAAGAAGATAGC +GTTCATTGATGAATATGAAGAATACATCACGAATGAAAAAGATTATCATATTTTACAAAT +GTTAAAACAACGAGAAAGCCATAATAGGATCATGAGCATTCTTGATATAGGCAGAGACAA +TTTTTATTCTAGAGTAAAAGATATAGTAAATATACTTTATAACTTGCAACAAGAAACCGA +CAGTTCGGACACATCGTACAGTTCGGACACATCGTACAGTTCGGACACATCGTACAGTTC +GGACTAATTTTGATGCTACATATTGTTTTTTATTATAATTGCTGTGTAGCAAAACATTTA +TATTTCTTTTGAACTCTCACATTAAGTGAGGGTTTTTATTTTTATAAACAAGAGGTGGAG +AATGGAGATATCAAAGTACCAAGAGATAGCTACACGTACACACAATGATGAATTGAATTT +AAATGAATATATTACTTGTTACGGCTTAGGTTTAACTCAATCTACAGGCAATGTTACAGA +TCTAATTAAACAGCATATGTTTTGTAATGTACCGATAGATAAAGGAATTATGATAAATGA +ACTTAGCGAAGCATTGTGGAATATAGCTAATCTTACTAACGTGTTAGGTATTAACTTGGA +TGAGATAGCTGGTCATAGTGTTAACACTATCTTGATGAATAAACCTAATCAGACTATCAA +TTTAGACAATGGTATAAAACGAGGAGACAAAGTATTGTTTCAAGGTAGTAAGTATCTTGT +TGATGGATCGATAGGAAACTTATTGTTAATTAGCAATGATAAAGATGATAGACAAGTAAC +TGTGCAAGATGTTAAGAAAGTCGACAAGGAGTGATGTGCATTGTCTATTATGAAGCGATG +TGGTCATCCAACATGTAATGTATTGATTAATCATAATGAAAGTTATTGTGATAAACACAA +GCAATATGCAAATGAAAATTACAATGATTTGAGACGTCGAAACGATCCAGAGTATTTAAG +ATTTTATAAATCGAAAACGTGGCAAAACATGCGTCGAATTGTATTGTTAGAACATGATTT +TATTTGTGTTTCTTGTGGCAATCAAGCGACTATGGTTGACCATATTGTACCAACAAAAAT +TGATTGGGCAAGAAGATTAGACAAAAGTAATTTACAGCCTTTGTGTGATGCTTGCCATAA +CCAAAAGACAAAAGAAGATTTGAAGAAATATTAAAAAAGATAAAAATAGGAAGTCACCCC +AAAGATGAAACGGGCGTCAATGAAAGGTTCTGGAGAACGGAGCAGAGTTTTCTTCTCAAA +AAATTCCCTTTATTTAAGTTTTTTTAGTAGGAGGTGCTAATTTATGGCGGGTAGACCTAA +GAAGCTTTTGTCAAATTCGAACAAGAATTATACAAAAGAAGAAATTATTGAAAAAGAGCG +TCAAGAAGCTCAATTAAATAAATTTTCTAAAATCGATACTGAACCACCGCACTTTTTAGA +TGAAATAGCGAAACAAGAATACTTAAGAATATTACCGCACATGCAAGAATTGCCAATTTC +CAACTTAGATAAAGCACAATTAGCACAATATTGTAGTTTTTATAGTGACTTTGTTAAAGC +AAGTTTGATTTTAGAGCGCGAAGACTTGATTTTAGAAGACGACAAAGGAAATCAAAAGGT +TAATCCGGCGTTCAACATAAAGGAAAAAGCGGGTATTCGATTGCAACAAACAGCTAATAC +TTTAGGATTAACTATTGATAGCCGATTGCGTATTATGGTTCCTGATGAAAAAGAAGATGA +TGATCCATATATGGAATTTGTGAGTGATTAGTAATGACTGATTATGTTACTAAATACGCA +AAAAAGGTAGTTTCAGGAGAAATTTTGGCAAGTTTGAAGAATATTCAAGTATGTAAACGT +CACCTATCTTTTATGGAGAACCCGCCGAATGGTTGCCATTGGGATAATCATTTGTCTAAC +AAAGCAATTAAATTTGTGGAAATGCTTCCAGACCCTAAAACAAACCAGCCCATGCCTCTT +ATGGAGTTTCAGAAATTCATTGTTGGGAGCTTATACGGCTGGCGTAGAGGTCAATACAGA +ATGTTTACTAAAGCTTATATAAGTATGGCTAGAAAACAAGGTAAGTCTCTAATCGTATCG +GGAATGTCCGTTAACGAACTGTTGTTTGGACAATACCCTAAATTTAATAGACAAATTTAT +GTAGCTTCATCTACTTATAAGCAAGCGCAAACAATATTCAAGATGGCAAGCCAACAAGTA +AACCTAATGCGAAGTAAAAGCAAGTTTATCCGTGAAAAAACAGACGTAAGAAAGACAGAC +ATTGAAGATGTATTAAGTAGTTCAGTGTTTGCACCTCTTTCCAATAACCCAGATGCGGTT +GATGGTAAAGATCCTACAGTTGCTATTTTGGACGAATTGGCAAGTATGCCTGATGATGAG +ATGTACTCAAGGTTTAAAACAGGTATGACATTACAAAAAAATCCTTTAACCCTACTTGTT +TCAACGGCCGGAGACAATTTAAATAGTCAAATGTACCAAGAGTATAAGTATATTAAACGT +ATTTTAAATGAAGAAGTAAGAGCTGATAATTACTTTGTATATTGTGCTGAAATGGATTCA +CAAGAAGAAGTTCAAGATGAAACAAAGTGGATTAAAGCAATGCCGCTTTTAGAATCAAAA +GAACATAGAAAAACTATACTTCAAAATGTAAAAGCTGATATACAAGACGAATTAGAAAAA +GGGACATCATATCATAAGATTTTGATTAAAAACTTCAATTTATGGCAAGCGCAAAGAGAA +GATAGCTTGCTAGATATTTCAGATTGGGAACAAGTAATAACGCCTATGCCTAATATCAAT +GGTAAAGATGTGTATATAGGTGTCGACTTATCGAGATTGGATGACTTAACATCTGTAGGG +TTTATTTTCCCTAACGACGATAAAAAAGTGTTTTTACATAGTCATTCTTTCATTGGATTA +AGAACAAACTTAGAACAAAAATCTAAGAGAGACAAAATAAATTATGAATTAGCGATTGAA +CGTGGCGAAGCTGAGACTACACAATCAGATAGCGGCATGATTGATTATAAACAAGTTATC +GATTTTATAGTGAAATTTATAACGACGCATGACCTGAATGTACAGGCTGTTTGCTATGAC +CCTTGGAATGCGCAAAGTTTTATAACAACAATCGAATCAATGGCTTTAGATTGGCCACTC +ATTGAAGTGGGACAAAGTTTTAAGGCGTTATCACAATCTATTAAAGAATTTAGAATGTGG +GTTGCAGATGAAAGAATACAGCATAACGATAATATGTTACTTACAACATCAGTTAATAAT +GCCGTTTTGATTCGTGACGGAGAAGACAATGTGAAAATAAATAAAAAAATGAATCGTCAA +AAAATAGATCCGATTATTTCGATTATCACAGCTTTCACTGAAGCTAGAATGCACGAATTC +CAAGAAAATTGGACGGAGAAATATGAAAGCGAAGAATTCGGATTTTAAAGGTGGTGACAA +AATGGACTTGAATAAAATAAATGTCTTTTTTAATTTCTTGGTTGCTAATTTGGTTAGCAT +CCTTTTTTTATTAGGTTTGTTTGTGGTTAATGTTTCTGTGTATAAAGCATTCGGTCAAAA +TATAGGACTTTTATGCATTGGTATAACACTGATTGTTATTTCGTTGATTTTAAATCACGA +AAGCAATCAAGAAAGGAGTTAGTAGTTGTGGGGATTTTTTATAAAAATGAAAAACGAGAC +TTGCAATACAACGAAGATGATTTGCAAATGATGGTTCAAACTTTGCCAGGTTTTCAAGGA +ACAAAATTACGACAATATAAAGATATAGAAGCAATTAGGCATAGCGACATCTTTACGGCA +GTTATGATGATTGCTTCTGATTTGGCGCGCATGCCAATTAGGGTGACAGTGAACGGCCAA +ATTAATTATAGTGACAGGATTGTTAATTTGTTAAATACACGTCCTAACCCAATGTATAAC +GGCTATATATTCAAATTAGTAGTGTTTGTTAGTGCCTTACTAACATCGCACGGCTATATT +GAAATTACACGTGATAAAACAGGAGAACCTATGAATTTAACGTTCAGAAAGACATCCGAA +ATAGAATTGAAATCAGACGCAAGAGGTCGACTGTATTATTTTCATCAAAGGATAGACAGT +AACGGAAATAATATAGAACGTAATGTTAAGTTTGAGGATATGCTAGACATCAAATTTTAT +TCGTTGGATGGTATAAATGGTTTGTCACTGTTAGACACATTAAGTCGCACGATAGAATCA +GATAACAATGGAAAAGATTTCCTTAATAATTTCTTGCGAAATGGCACACATGCTGGTGGT +ATTTTGAAAATGAAAGGTGTATTAGATAATAAAAAAGCAAGAGACCGTGCCAGAGAAGAA +TTTCACAAAAGTTTTAGTGGAACTAAACAAGCTGGGAAAGTTGTCGTACTCGATGAATCA +ATGACGTTTGATCAATTAGAAGTTGATACAGAAGTTTTAAAGCTTATCAGAGAAAACAAA +TCATCAACAAGAGAAATAGCAGGTGTATTTGGTATTCCATTGCATAAGTTCGGCATAGAA +ACAGCGAACATGAGTATCACGGATGCTAATTTAGATTACTTATCAACTTTAAAACCTTAT +ATTACATGCGTTTGTGCAGAATTGAATTTTAAGTTTAATGATGAATATGTGAATCGTGAA +TTTAAATTTGATACCACTGAAATACGAGTTGTTGATGAAAAAACACAAGCTGAAATTGAC +AAAATTAACATTGATTCTGGAAAGATGAATATCGATGAAATTAGACAACGTGATGGATTA +GCGCCAATACCAGGCGGTAATGGTAGCATTCACAGAGTCGATTTAAACCATGTAAATATT +GAACTTGTAGATGAGTATCAGATGAATAAATCGAGAGCTACTGATAAAAAATTGAAAGGT +GGTGAGGAAAATGAGTAAGGAAACGAGAGTTGGCAACATTATTGAGGTACGCTCAAATGA +TAACAACGAAATGGTCATAGAGGGGTATGCGTTAAAGTTTGACACTTGGTCTGAAAATCT +TGGTGGATTCAAAGAAACGATTTCACGTCGCGCTTTAGAAAACACTGATTTATCTGATGT +GCGTTGTTTAGTAGATCATATCCCATCGCAAATAATTGGTAGGACAAAATCGGGTACTTT +GGAGCTCGAAACTGATGATGTTGGACTTAAATATCGTTGTAAGTTACCAAACACAACATT +TGCACGTGATTTATATGAGAACATGCGTGTAGGCAACATCAATCAATGTTCGTTTGGTTT +TATGCTTGACGATAAAGGCGATGAAGTGCGTTTTGATGAACAAGAAAACATTTACAAACG +TACTTTAACAGCAATTCGTGAACTTACAGATGTTTCTGTAGTGACTTATCCGGCTTACAA +AGACACTGATGTTAAACCAGCATTACGTAGTATTGAAACCGTTAAAAAAGAACAACGTAA +AAAAGAATTAGAAATAAGACTAAAGAAACACTCTATATTAAATAATATTTGGTGAAGTTG +AACACCATTATCAAATACAGCCATTGGACATGCTGAATATAGCGATGTCTATTTTTTTAT +GCCAATTTTAGGAGGAAATTAAATGAAAACAAAAGAAGAGTTACAATCTGAGATTTCAGA +CATTAAAAGACAAATTGATTTAAAGGTGAAGTATGCAACGAGAGCACTTAATAACGATGA +GTTAGAAAAAGCAGAAAAATTAGAACAAGAAATTACTGATTTACGTTCTCAAATCCAAGA +AAAACAAGAAGAATTAGATAAGCTAAAAGAAAAAGATGGAACTTCAGAAAACAATCAACA +ATCAGTGGAAGTAAACGAAGCAAGTACTTATCGAAATCAAGCAAACATTAATGATTTAGG +TATTTCGATTCAAAACACAAAGGTAACATCACAAGAAGTTAGAGATTTTACTGAATATCT +TGAAACACGCAATGATATTCAAGGTGGTTCGTTAAAAACAGACTCAGGATTTGTAGTTAT +TCCAGAGGAAATTGTTACAGATATTTTAAAATTAAAAGAGGTTGAGTTTAATCTTGATAA +GTATGTGACGGTCAAACGTGTTACAAATGGTTCTGGTAAATATCCGGTAGTACGACAATC +AGAAGTTGCAGCCCTTGAAAAAGTTGAAGAATTAGAAGAAAACCCTGAATTAGCAGTTAA +ACCATTCTTCCAATTAGCATATGACATTAATACACACCGTGGTTACTTCCGAATTTCACG +TGAAGCAATCGAAGATGCAAAAGTGAATGTTTTGCAAGAATTGAAACTATGGATGGCGCG +AACTATTGCAGCAACACGAAACAAAGCAATTATTGATGTTATCACTAAAGGATCAACGGG +TTCTACAAGTTCAGGTTTTGAAAAAGAAGGCAAGAAATTAGAAGTTAAAAAAGCAAAATC +TTTAGATGATATTAAAGATGCTATTAACCTGAATGTTAAGCCAAATTACGAACATAATGT +TGCGATTGTTTCGCAAACTATGTTTGCAAAATTAGACAAAATGAAAGATAAGCTAGGAAA +CTATTTAATCCAGCCAGATGTTAAAGAAAAAACGCAACAGCGTTTATTAGGAGCTAAAAT +CGAAATTTTACCTGATGAAGTACTAGGGCAAAAAGGTAATAACACTTTGATTATCGGTAA +CTTAAAAGATGCGATTGTTTTATTTGACCGCTCTCAATACCAAGCATCATGGACTGACTA +CATGCATTTCGGAGAATGTTTAATGATTGCTGTACGTCAAGACTGTAGAATTCTAGATTA +TAAATCAGCAATTGTGATTGAATATGATGATAGTGAACGCGGTGAAGGCGATCTTGGCTT +AGAAGCATAATAAGCGCTCGATACTTTATAAAGAGGTGATAAACTATGGCAATGTATGAA +GTGAAGAAATCTTATACTGACTTGGAAAAAGGCCAGTATTTAAAGTCAGGTAAACGTGTT +GAAATGACAGTAAAACGTGCTGAATATGTTAACAAAAAGCTGAAAGAGCATGGAGTAATA +CTTGAAAGAGTAAAAGAAGAATAGGTGATTGAATGCAATTAACAGCTGAGGAACTTAAGT +TATTAAAAAAGCATTGCAAAATAGATCACAATTCAGAGGACGACTTATTAGAAATATATT +ACTCTTGGGCATTCCGTGAAATAGCTAGCGCTGTTACGGATAAACCAAGTAAATATATTG +ATTGGTTTAAAAGTCATCCTCTATTTGCTCGTGCTATATACCCTTTAGCAAGTTACTATT +TTGAAAACCGTATTGCTTATTTGGATAGGGATTTATCGCTTGCGCCACATATGGTTTTAA +GTACGGTGCATAAATTGAGAGGTTCATTTGAGCAATTTTTGGAGAGTGAAAATGATGAAA +TTTAATTCCAATAAATTAAATGAACGTATAGATTTTTGTGAAGATGTAAGCGAGAGAGTG +AACGGAAATCCGATGAAACCGAAGACGAAAATATTATACTCTTGTTTCGCTTGCATTCAA +GAATCTAAAGAATCCGACACTCAAACGAATCTCAATACAGGTAGCAAATTCATTAAAACT +ATTATTATCAGAGATACACGAGGTGATTATAAACCAACAAATAAGCATTACGTCTTGCAT +GAAGGGCAAAGATTTAACATCAAATATGTAAAGCCAGATTATCAAGATAAATCTTATTTG +CGTATCTATGGCGAGGTGGTCATTTAATGGGGGCAAGAATTGAAAGTAATAACATCGAAC +AAGGTTTGAAAAATGCAGTTTTAAAAATGAATTTAAATAGTAATGTAATTGTCAAAGCTG +GGGCTATGTCATTAGTCCCGCTTTTAAAAAGTAATACACCTTTTGCGAATACTAAAAAGC +ATGCTCGCGATCACATAGCTGTTTCTAATGTGAAAACAGACAGACACACAAGTGAGAAAA +TTGTTACAATTGGTTACGCTAAAGGCGTCTCACATCGTATTCATGCAACAGAATTTGGAA +CAATGTACCAAAAACCACAATTGTTTATAACAAAAACAGAAAAGCAAGGGAAAAACAAAG +TTTTAAAAACAATGCTTGATACTGCTAAGAGGTTGCAAAAATGATTAATGTTACCAAATT +AATTAGAAACGCTATTATTGCAAATAACATTACAGATGAAGTGAATGTGTTTAACTACAC +TATAGATGACCATTTTCACGAAAAAACTGACAAGCCTATTATTCGTATATATCCCTTACC +GTTCAATCCTGACACATACGCTGATGATAACGAGATTTCAAGAGAATACCATTACCAAAT +TGATGTTTGGTGGTCTCAAGATGAACCGAACGAGCAAGCAGAAAAAATTGTTGAGTTACT +CAAAGTGATAAATTTTCAATGTTATTACAGAGAACCGTTATACGAGAGTGACGTCATGTC +ATTCAGACATATTATAAGAGCAAAAGGCTCGATTTTATCAATGAAATTGGAGGAAAATTA +AATGATTGAAAAATTGAAACAAGCACCAAGATTTTTAAAATTAAACTTACAACATTTTGC +AGATACAGGAGTTTCGGGTATCGCAATTGGGGTATCAAACTTTTATTATGCACCTATTTT +AAAAGATACAGAAAATGAATGGGAAACTGGAGCTGGCACACGTATTCGTTTCTTAAAAGA +AATTGAAGTAGACCGTCCACAAGATACCGAGGAAGATTATGGGGATGATATGGTCGCAGC +AACTGCTGTATCTAATGGCAAACTAAGTGTTAAGACAACATTTGTTACTGTTCCTGCTGA +CGATAAGGCGTTCTTGAATGGCGCTAAAAAAGGTGTAGGTGGTTATAAATATGGAGCTAA +GGATATCCCGCCAGATGTAGCGATTGTATTTGAAAGACGTAATCATGATGAGTCTTCAGA +ATGGGTTGGCTTGTTCAAAGGTAAATTCACTCGTTCAAGCATCAAAGGGCAAACAAAACA +AGATAAAGTTGAATTCCAGAATGACGACGTAGAAGGCAATTTTATTGATCGTTTGTTTGA +TGAGAGCTCGCATGTTACTGGCTATGATAAAAAAGGAAGCACTACAGGGCGCGATTATGT +ATTCATGGAAACATTTGGTAAAACTTATGATGAATTCATGTCTAGTCGAGGAGAACAAAA +TATGGAACCTGTAGAAAAAGAAATGAAAAAAACAGAAAAAGTTGAAGTCACTTCTGTAAA +CGTCACTGATGAACAAGTTACAGTTAAAGTTGATGCTACTAAACAACTATCAGCCACAAC +CGAACCATCTGGACAGAAAGTAACTTATGCAGTGACTGAGGGGCAAACGTATGCTAGCGT +AACATCAACTGGCCTCGTTAAAGGTTTGGCGGAAGGTAATGCGACCGTTACAGCGACTGC +AGGAAAGCAAACTGATACTGTGCAAATTACAGTACAATCTAATTTAGAAATGTAAGTTTT +GAGGGCTTAACGCCCTCTTTTTATTTTGGCCAAATTAAAAAGAAAGTAGGAATTTAATAA +TGGAACGTACATCAATTGAATTAATTACAGGATTTACAAAAACAGGAAAGCCGCAATATC +AAAAGTATTTAGCGAAGCCGATTATTACTTTGTTTGAAACAATTCAAGGTTCAAAATTAG +GTTTGAAACTTAACAAAGCCTTTAAGGGGGCTGATTTTAAAGATCTAACAGAAGAAGAAT +TTAATAACTTAAGTGTGACAGAACAGGAAGAATACAAAAACAAGCAAGAAGAATACGAAA +ACAACATGGCTGTACAAATGGAAGTATTAGAAGAAGTTTTGGATTTCATCGTTGAAGCTT +TTGATAATCAATTTACCAGTATAGAACTTCAAAAAGGATTACCAAATGGTCAAGAAGGTA +TTGAAAAGATTGGACAGTTAATTGGACGAATTACAGGTGGGGAACCTAGCGATACAAAAA +AGTTCGTGACAGAGAATCAGAAATAAGAAAAGAAGATTTAACACCTGAAGCTGTCTACAA +CAATTACAGGAAAATAGCTAAAGATTTGATAGAAAAAGGCATGGATGCAGAAAAAGTGGC +TAACATGCCGATACACTTCTTTTTAGACATTGTCGAATCGAAGATTGAAACAAAGCGAAC +TGCGAAAAGTTTTAAAGATATTTTTTAATCAGCCTTTAAAGGTTGATTTTTTATTTACAT +CTTGGAAGAAAGGAGGTTTTTAAATGCCTAATCCTATAGGTAATATGGTCATAAAGGTTG +ATTTAGATGGTTCTGGATTCAATAGAGGTGTGACAGGTTTAAATAGGCAAATGAAAATGG +TTTCGCGTGAGCTTTCGGCTAATTTATCACAATTTTCTAGATATGATAATTCATTAGAAA +AGTCGAAGATAAAAGTCGAAGGTTTGAGTAAAAAACAAAAAGTTCAAGCCCAGATTACTA +AAGAGCTGAAAGATAGTTATGACAAACTTAGTAAAGAAACTGGTGAAAACAGTGCAAAGA +CACAAGCTGCGGCTGCTAAATACAATGAAGCTTACGCTAAATTAAACCAATATGAGCGAG +AGTTAAATCAAGCCACACAAGAATTAAAAGACATGCAAAGAGAGCAGAAAGCATTAAATA +CTGCAATGGGAAAACTTGGTACCAACTTTAATAATTTTGGTCCTAAACTTCAAGAAATTG +GTAACAGTATGAAAAATGTAGGCCGTAACATGACTATGTATGTAACTGCGCCGGTGGTTG +CTGGGTTTGCTGTAGCAGCTAAAAAAGGTATTGAATTCGATGACAGTATGAGAAAAGTTA +AAGCAACTTCAGGTGCTACTGGGGAAGAGTTTGAAGCTTTGAAGAAAAAGGCTCGCGAAA +TGGGTGCAACAACAAAATTTAGTGCATCAGATTCGGCTGAAGCATTAAATTACATGGCAC +TTGCTGGTTGGGATTCTAAGCAAATGATGGAAGGTTTAAGCGGAGTTATGGATTTAGCGG +CAGCATCTGGCGAAGAACTGGAAGCAGTAAGTGACATTGTTACAGATGGACTAACGGCAT +TCGGTTTAAAAGCAAAGGATAGTGGTCATTTTGCGGACATTTTAGCACAAACTAGCTCGA +AGGCAAATACGGATGTTAGAGGGCTCGGAGAAGCTTTTAAATATGTCGCTCCTGTAGCAG +GTGCGTTAGGTTACACGATTGAAGATACATCTATTGCGATAGGTTTAATGAGTAATGCTG +GTATCAAAGGTGAAAAAGCAGGTACAGCGTTACGAACAATGTTCACCAATCTTTCAAGTC +CAACTAGAGCTATGGGGAATGAAATGGAACGCTTAGGAATATCTATTACAGATAGTAATG +GGAAAATGATTCCTATGCGAAAGCTTTTAGACCAACTGAGGGAAAAATTTAAACATCTTT +CAAAAGACCAACAAGCTAGTTCTGCAGCTACAATATTTGGTAAAGAAGCGATGTCAGGAG +CATTAGCGATTATAAATGCTTCTGATGAAGACTATCAAAAGTTAACCAAATCTATAGATT +CATCTACCGGCGCATCTAAAAGAATGGCCGATACAATGGAATCTGGTTTAGGTGGGAAAT +TAAGAACTTTAAGGTCGCAATTAGAAGAACTAGCCTTAACGATTTATGACAGAATAGAAC +CAGCACTAAAGATTATAGTAAGTGCTTTTAGCAAAGTAGTGACATGGGTTACTAAATTAC +CAACGTCAATTCAATTAGCGGTTGTTGGGTTTGGATTATTTGCAGCAGTTTTAGGTCCTT +TAGTTTTTATGTTCGGTTTATTTATCAGCGTGATGGGGAATGCAATGACAGTTTTAGGAC +CCTTGTTAATAAACGTTAATAAAGCTGGTGGTTTATTCGCGTTTTTAAGAACTAAAATCG +CATCACTTGTTAAACTATTTCCGATTTTAGGTGTGTCGATATCAAGTTTAACGTTACCTA +TAACATTAATTGTAGGTGCATTAGTTGGTATTGGCATAGCTTTCTATCAAGCTTATAAAC +GTTCAGAAACTTTTAGAAATATTGTAAATCAGGCAATCTCTGGTGTAGCAAACGCATTTA +AAGCAGCTAAACTAGCGTTACAAGGTTTCTTTGATTTATTCAAAGGTGATAGTAAAGGCG +CGGTTACCCTAGAGAAGATATTTCCACCCGAAACTGTAGCAGGAATACAAAATGTAGTTA +ATACGATTAGAACAACTTTCTTTAAAGTAGTTGATGCAATCGTTGGTTTCGCCAAAGAGA +TAGGCGCTCAATTAGCCTCTTTCTGGAAAGAGAACGGCTCAGAAATAACACAAGCTTTGC +AAAATATAGCTGGTTTCATTAAAGCAACCTTTGAATTTATTTTTAACTTTATTATTAAAC +CAATCATGTTTGCGATTTGGCAAGTGATGCAATTTATTTGGCCGGCGGTTAAAGCTTTGA +TTGTCAGCACTTGGGAAAATATCAAAGGTGTAATACAAGGGGCTATTAATATTATTTTGG +GTATTATCAAAGTGTTCTCTAGTCTTTTCACAGGAAACTGGCGAGGCGTTTGGGACGGCA +TTGTAATGATACTGAAAGGTACTGTGCAGTTAATTTGGAATTTAATACAACTGTGGTTTG +TAGGTAAGATTCTAGGTGTTGTTAGATACTTTGGTGGATTGCTTAAAGGTTTAATATCCG +GTATCTGGGGTGTTATCAAAGGTATTTTCACAAAATCATTATCTGCAATTTGGAATGCAA +CGAAAAGTATTTTTGGTTTCTTATACAATAGTGTTAAATCTATTTTCACTAATATGAAAA +ACTGGTTATCTAGTACGTGGAATAATATCAAAAGCAATACCGTCGGCAAGGCTCATTCGT +TATTTACGGGTGTAAGGTCTAAATTCACAAGTTTATGGAATGCGACGAAAGATATATTTA +CTAAATTAAGAAATTGGATGTCAAACATCTGGAACTCTATTAAAGATAACACGGTAGGTA +TAGCTGGTCGTTTGTGGGATAAAGTACGTAATATCTTCGGAAACATGCGTGACGGTTTAA +AATCTATCATTGGTAAAATTAAAGATCATATCGGCGGTATGGTAGATGCTATTAAAAAAG +GACTTAATAAATTAATTGAAGGCTTAAACTGGGTCGGTGGTAAGTTAGGTATGGATGAAA +TACCTAGGTTACACACTGGTACAGAGCACACACATACTACTACAAGATTAGTTAAGAACG +GTAAGATTGCACGTGATACATTCGCTACAGTTGGGGATAAAGGACGTGGAAATGGTCCAA +ATGGTTTTAGAAATGAAATGATTGAATTCCCTAATGGTAAACGTGTAATCACACCTAGTA +CAGACACTACTGCTTATTTACCTAAAGGCTCAAAAGTATACAACGGTGCACAAACTTATT +CAATGTTAAACGGAACGCTTCCGAGATTTCATTTCGGTACTACTATGTGGAAAGATATTA +AATCTAGTGCATCATCGGCATTTAACTGGACAAAAGATCAAATAGGTAAAGGCACAAAGT +GGCTTGGCGATAAAGTTGGTGATGTCATGGACTTTATCGATAATCCAGGCAAACTTTTAA +ATTATGTACTTCAAGCGTTTGGAGTTGATTTCAGTTCTCTAACTAAAGGTATGGGTATTG +CTGGCGATATAACAAAAGCTGCATGGTCTAAGATTAAGAAAAGTGCAATCAAGTGGCTTG +AGGATGCTTTCGCAGAGTCGGGTGATGGCGGTGTATTAGATATGAGTAAATTACGTTACT +TATACGGTCACACTGCTGCTTATACACGAGAAACCGGACGCCCATTCCATGAAGGTCTGG +ATTTTGATTACATTTACGAACCTGTTCCATCAACCATTAATGGTAGAGCACAAGTTATGC +CTGTTCATAATGGTGGTTATGGAAAATGGGTGAAAATTGTAAAGGGCGCCTTAGAAGTTA +TTTATGCACATTTATCTAAATATAAAGTTAAAACTGGTCAACAAGTTAGGGTCGGACAGA +CTGTTGGTATATCGGGGAATACGGGGTTTAGTACAGGACCTCACTTACATTATGAGATGC +GTTGGAATGGAAGACATAGAGACCCGTTACCGTGGTTAAGAAAGAATAATGGGGGCGGCA +AAAGTACACCCGGTGGTAATGGTGCAGCTAATGCTAGACGAGCTATTAAGGCTGCTCAAA +ATATTTTAGGAGGAAGGTATAAGGCGAGTTGGATTACTAACGAGATGATGCGTGTTGCGA +GTCGTGAATCCAATTATACAGCTAATGCAGTCAATAATTGGGATAGCAACGCAAGAGCTG +GTATACCTTCAAGAGGTATGTTCCAAATGATAGATCCTTCATTTAGAGCGTACGCAAAGT +CGGGTTACAATAATCCTCTCAACCCAACTCATCAAGCTATATCGGCTATGAGATATATTG +TGGGTAAATGGGTACCAAGAACAGGCTCATGGAGAGCTGCGTTCAAACGCGCTGGTGATT +ACGCATATGCTACTGGTGGCAAAGTCTATAACGGATTGTATCACTTAGGGGAAGAAGGAT +ATCCAGAGTGGATAATACCTACTGATCCAAGTAGAGCGAACGAAGCACACAAATTATTAG +CTTTAGCTGCTAACGATATTGATAACCGCTCTAAAAATAAGCGACCAAACAACTTACCAA +ATCCAAGTATAAGTAATAGTGATACAAACTATATTCATACATTGGAGAATAAACTGGATG +CGGTTATTAATTGTTTGGTTAGTTTGGTTGAGTCTAATCAAGTTATTGCAGATAAGGATT +ACGAACCAGTTATTAATAAGTATGTGTTTGAAGATGAGGTAAATAATTCTATCGATAAAC +GAGAGCGTCACGAATCTACAAGAGTTAGATTTAGAAGAGGAGGCACGATAATCTAATGCA +AGATACAATTCAAATAGACAATAAAACAATTGGATGGCTGGTTGTGCAAAGAGGGTTCGA +GATACCCTCTTTTAATTTTGTTACTGAAAAAGAAAACGTAAAAGGTAGAGCGGGATCTAT +TGTTAAGAATCGTTATTTAAATGATATCGAATTTGATTTACCATTAATTATTCGAAACGA +AAAATTGTCACCAGGTGGAGAAAAAACACACGATGATATATTAGAAGCATTGGTCAAGTT +CTTCAATATTAAAGATTTAACACCTAAAAAACTTAAATTCAAATCTCAAAACTGGTATTG +GTTTGCATATTTTGATGGTCCATTAAAATTACCGAAAAACCCAAGAGGTTCAGTGAAGTT +CACTATAAAAGTAGTGTTAACAGATCCTTATAAATACTCGGTAACTGGAAACAAAAACAC +CGCGATTTCAGACCAAGTTTCAGTTGTAAATAGTGGGACTGCTGACACTCCTTTAATTGT +TGAAGCCCGAGCAATTAAACCATCTAGTTACTTTATGATCACTAAAAATGATGAAGATTA +TTTTATGGTTGGTGATGATGAGGTAACCAAAGAAGTTAAGGATTACATGCCTCCTGTTTA +TCATAGTGAGTTTCGTGATTTCAAAGGTTGGACTAAGATGATTACTGAAGATATTCCAAG +TAATGATTTAGGTGGTAAGGTCGGCGGTGACTTTGTGATATCCAATCTTGGCGAAGGATA +TAAAGCAACTAATTTTCCTGATGCAAAAGGTTGGGTTGGTGCTGGCACGAAACGAGGGCT +CCCTAAAGCGATGACAGATTTTCAAATTACCTATAAATGTATTGTTGAACAAAAAGGTAA +AGGTGCCGGAAGAACAGCACAACATATTTATGATAGTGATGGTAAGTTACTTGCTTCTAT +TGGTTATGAAAATAAATATCATGATAGAAAAATAGGACATATTGTTGTTACGTTGTATAA +CCAAAAAGGAGACCCCAAAAAGATATACGACTATCAGAATAAACCGATAATGTATAACTT +GGACAGAATCGTTGTTTATATGCGGCTCAGAAGAGTAGGTAATAAATTTTCTATTAAAAC +TTGGAAATTTGATCACATTAAAGACCCAGATAGACGTAAACCTATTGATATGGATGAGAA +AGAGTGGATAGATGGCGGTAAGTTTTATCAGCGTCCAGCTTCTATCATAGCTATCTATAG +TGCGAAGTATAACGGTTATAAGTGGATGGAGATGAATGGATTAGGTTCATTCAATACGGA +GATTCTACCGAAACCGAAAGGCGCAAGGGATGTCATTATACAAAAAGGTGATTTAGTGAA +AATAGATATGCAAGCAAAAAGTGTTGTCATCAATGAGGAACCAATGTTGAGCGAGAAATC +GTTTGGAAGTAATTATTTCAATGTTGATTCTGGGTACAGTGAATTAATCATACAACCTGA +AAACGTCTTTGATACGACGGTTAAATGGCAAGATAGATATTTATAGAAAGGAGATGAGAG +TGTGATACATGTTTTAGATTTTAACGACAAGATTATAGATTTCCTTTCTACTGATGACCC +TTCCTTAGTTAGAGCGATTCATAAACGTAATGTTAATGACAATTCAGAAATGCTTGAACT +GCTCATATCATCAGAAAGAGCTGAAAAGTTCCGTGAACGACATCGTGTTATTATAAGGGA +TTCAAACAAACAATGGCGTGAATTTATTATTAACTGGGTTCAAGATACGATGGACGGCTA +CACAGAGATAGAATGTATAGCGTCTTATCTTGCTGATATAACAACAGCTAAACCGTATGC +ACCAGGCAAATTTGAGAAAAAGACAACTTCAGAAGCATTGAAAGATGTGTTGAGCGATAC +AGGTTGGGAAGTTTCTGAACAAACCGAATACGATGGCTTACGTACTACGTCATGGACTTC +TTATCAAACTAGATATGAAGTTTTAAAGCAATTATGTACAACCTATAAAATGGCATTGGA +TTTTTATATAGAGCTTAGTTCTAATACCGTCAAAGGTAGATATGTGGTACTCAAAAAGAA +AAACAGCTTATTCAAAGGTAAAGAAATTGAGTATGGTAAAGATTTGGTTGGGTTAACTAG +GAAGATTGATATGTCAGAAATCAAAACAGCATTAATTGCTGTGGGACCCGAAAATGACAA +AGGAAAGCGTTTAGAGTTAGTTGTGACTGATGACGAAGCACAAAGTCAATTCAACTTACC +TACCCGTTATATTTGGGGAATATACGAACCTCAATCAGATGATCAAAATATGAATGAAAC +ACGGTTGCGTTCTTTAGCCAAAACAGAGTTAAATAAACGTAAGTCGGCAGTTATGTCATA +TGAGATTACTTCTACTGATTTGGAAGTTACGTATCCGCACGAGATTATATCAATTGGTGA +TACAGTCAGAGTAAAACATAGAGATTTTAACCCGCCATTGTATGTAGAGGCAGAAGTTAT +TGCCGAAGAATATAACATAATTTCAGAAAATAGCACATATACATTCGGTCAACCTAAAGA +GTTCAAAGAATCAGAATTACGAGAAGAGTTTAACAAACGATTGAACATAATACATCAAAA +GTTAAACGATAATATTAGCAATATCAACACTATAGTTAAAGATGTTGTAGATGGTGAATT +AGAATACTTTGAACGCAAAATACACAAAAATGATACACCGCCAGAAAATCCAGTCAATGA +TATGCTTTGGTATGATACAAGTAACCCTGATGTTGCTGTCTTGCGTAGATATTGGAATGG +TCGATGGATTGAAGCAACACCAAATGATGTTGAAAAATTAGGTGGTATAACAAGAGAGAA +AGCGCTATTCAGTGAATTAAACAATATTTTTATTAATTTATCTATACAACACGCTAGTCT +TTTGTCAGAAGCTACAGAATTACTGAATAGCGAGTACTTAGTAGATAATGATTTGAAAGC +GGACTTACAAGCAAGTTTAGACGCTGTGATTGATGTTTATAATCAAATTAAAAATAATTT +AGAATCTATGACACCCGAAACTGCAACGATTGGTCGGTTGGTAGATACACAAGCTTTATT +TCTTGAATATAGAAAGAAATTACAAGATGTCTATACAGATGTAGAAGATGTCAAAATCGC +TATTTCAGATAGATTTAAATTATTACAGTCACAATACACTGATGAAAAATATAAAGAAGC +GTTGGAAATAATAGCAACAAAATTTGGTTTAACGGTGAATGAAGATTTGCAGTTAGTCGG +AGAACCTAATGTTGTTAAATCAGCTATTGAAGCAGCTAGAGAATCCACAAAAGAACAATT +ACGTGACTATGTAAAAACATCGGACTATAAAACAGACAAAGACGGTATTGTTGAACGTTT +AGATACTGCTGAAGCTGAGAGAACGACTTTAAAAGGTGAAATCAAAGATAAAGTTACGTT +AAACGAATATCGAAACGGATTGGAAGAACAAAAACAATATACTGATGACCAGTTAAGTGA +TTTGTCCAATAATCCTGAGATTAAAGCAAGTATTGAACAAGCAAATCAAGAAGCGCAAGA +AGCTTTAAAATCATACATTGATGCTCAAGATAATCTTAAAGAGAAGGAATCGCAAGCGTA +TGCTGATGGTAAAATTTCGGAAGAAGAGCAACGCGCTATACAAGATGCTCAAGCTAAACT +TGAAGAGGCAAAACAAAACGCAGAACTAAAGGCTAGAAACGCTGAAAAGAAAGCTAATGC +TTATACAGACAACAAGGTCAAAGAAAGCACAGATGCACAGAGGAGAACACTGACTCGCTA +TGGTTCTCAAATTATACAAAATGGTAAGGAAATCAAATTAAGAACTACTAAAGAAGAGTT +TAATGCAACCAATCGTACACTTTCAAATATATTAAACGAGATTGTCCAAAACGTTACAGA +TGGAACAACAATCAGATATGATGATAACGGAGTGGCTCAAGCTTTAAATGTGGGGCCACG +TGGTATTAGATTAAATGCTGATAAAATTGATATTAACGGTAATAGAGAAATAAACCTTCT +TATCCAAAATATGCGAGATAAAGTAGATAAAACCGATATTGTCAACAGCCTTAATTTATC +AAGAGAGGGTCTTGATATCAATGTTAATAGAATTGGAATTAAAGGCGGTAACAATAACAG +ATATGTTCAAATACAGAATGATTCTATTGAACTAGGTGGTATTGTGCAACGAACTTGGAA +AGGCAAACGATCAACCGATGATATATTCACACGTCTTAAAGATGGACATCTAAGGTTTAG +AAATAATACCGCAGGCGGTTCACTTTATATGTCACATTTTGGTATTTCAACATATATTGA +TGGAGAAGGCGAAGACGGAGGTTCATCCGGTACTATTCAATGGTGGGATAAAACTTACAG +TGATAGCGGTATGAATGGCATAACAATCAATTCCTATGGTGGTGTCGTTGCACTAACGTC +AGATAATAATCGGGTTGTTCTGGAGTCTTACGCTTCATCGAATATCAAAAGCAAACAGGC +ACCGGTGTATTTATATCCAAACACAGACAAAGTGCCTGGATTAAACCGATTTGCATTCAC +GCTGTCTAATGCAGATAACGCTTATTCGAGTGATGGTTATATTATGTTTGGTTCTGATGA +GAACTATGATTACGGTGCGGGTATCAGGTTTTCTAAAGAAAGAAATAAAGGTCTTGTTCA +AATTGTTAATGGACGATATGCAACAGGTGGAGATACAACAATCGAAGCAGGGTATGGCAA +ATTTAATATGCTGAAACGACGTGATGGTAATAGGTATATTCATATACAGAGTACAGACCT +ACTGTCTGTAGGTTCAGATGATGCAGGAGATAGGATAGCTTCTAACTCAATTTATAGACG +TACTTATTCGGCCGCAGCTAATTTGCATATTACTTCTGCTGGCACAATTGGGCGTTCGAC +ATCAGCGCGTAAATACAAGTTATCTATCGAAAATCAATATAACGATAGAGATGAACAACT +GGAACATTCAAAAGCTATTCTTAACTTACCTATTAGAACGTGGTTTGATAAAGCTGAGTC +TGAAATTTTAGCTAGAGAGCTGAGAGAAGATAGAAAATTATCGGAAGACACCTATAAACT +TGATAGATACGTAGGTTTGATTGCTGAAGAGGTGGAGAATTTAGGATTAAAAGAGTTTGT +CACGTATGATGACAAAGGAGAAATTGAAGGTATAGCGTATGATCGTCTATGGATTCATCT +TATCCCTGTTATCAAAGAACAACAACTAAGAATCAAGAAATTGGAGGAGTCAAAGAATGC +AGGATAACAAACAAGGATTACAAGCTAATCCTGAATATACAATTCATTATTTATCACAGG +AAATTATGAGGTTAACACAAGAAAACGCGATGTTAAAAGCGTATATACAAGAAAATAAAG +AAAATCAACAATGTGCTGAGGAAGAGTAATCCTTAGCACTATTTTTATACAAAAATTTAA +GGAGGTCATTTAATTATGGCAAAAGAAATTATCAACAATACAGAAAGGTTTATTTTAGTA +CAAATCGACAAAGAAGGTACAGAACGTGTAGTATATCAAGATTTCACAGGAAGTTTTACA +ACTTCTGAAATGGTTAACCATGCTCAAGATTTTAAATCTGAAGAAAACGCTAAGAAAATT +GCGGAGACGTTAAATTTGTTATATCAATTAACTAACAAAAAACAACGTGTGAAAGTAGTT +AAAGAAGTAGTTGAAAGATCAGATTTATCTCCAGAGGTAACAGTTAACACTGAAACAGTA +TGAAAAGCTATGAGTTAGATACTCATAATCTTTATTCTTTTAGAAAGCGGGTGTACTGAA +TTGGGGTGGTTCAAAAAACACGAACATGAATGGCGCATCAGAAGGTTAGAAGAGAATGAT +AAAACAATGCTCAGCACACTCAACGAAATTAAATTAGGTCAAAAAACCCAAGAGCAAGTT +AACATTAAATTAGATAAAACCTTAGATGCTATTCAAAAAGAAAGAGAAATAGATGAAAAG +AATAAGAAAGAAAATGATAAGAACATACGTGATATGAAAATGTGGGTGCTTGGTTTAGTT +GGGACAATATTTGGGTCGCTAATTATAGCATTATTGCGTATGCTTATGGGCATATAAGAG +AGGTGAATAAAATGTTTAAACTAATCTTTGGTTATAGTTTCTGGACATGTTTTTGGTTCG +GTAAATGTAAATAAGTTTTAGTCAGTGCTTCGGTACTGACTTTTTATTTATTGTTGTAAT +TATGGTAATATGCAGAAGTGAGCAAGTTGGATAGATGGTGGCTATCTGAGTATAAGGAGG +TGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCTAATGATTACAATTA +GTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTA +TTGAATTAAGCAATAAAAAATAACCATCGCTAACTTTGGCTGGTTTCGATGGTTAAATGG +TTATTAATTTAATCTTTAATCTAAAATAGCCACCGTCTTTTTAACGGGCTCATTAGGGTA +ACATGTTTGCGCATGTTGCCCTTTTTCTATATATAAATTAACACACCATAATATAAATAT +CAAATAGACGGCTTATTAGTCGTCTTTTTATTTTGGGTAAAAGGAGATAAGAATATGATT +AATTGGAAAATTAGAATGAAACAAAAATCATTTTGGGTAGCGATATTGTCAGCTATCTTT +TTATTTGCTCAAAACATCGCAAAAGCTATTGGGTATGATATCCAAGTTTATACAGAGCAA +TTAACAGACGGTTTAAACGCTATATTAGGATTTTTAGTATTAACTGGTGTGATTCAAGAC +CCGACTACTAAAGGTATAGGTGATAGCCACCAAGCTTTAGAATATGAAGAACCAAGAAGA +AAATACTAGGAGGTAAAATAATGAAAACATACAGTGAAGCAAGAGCAAGGTTACGTTGGT +ATCAAGGTAGATATATTGATTTTGACGGTTGGTATGGTTACCAATGTGCAGATTTAGCAG +TTGATTACATTTATTGGTTGTTAGAAATTAGAATGTGGGGAAATGCAAAAGATGCAATCA +ATAACGATTTTAAAAACATGGCAACAGTATATGAAAACACACCATCGTTTGTTCCACAAA +TAGGTGATGTGGCTGTATTTACCAAAGGAATATATAAACAATACGGTCATATTGGTTTAG +TGTTTAATGGTGGTAATACAAACCAATTTTTAATTTTGGAACAGAACTATGACGGTAACG +CAAATACGCCTGCAAAGTTACGTTGGGATAATTATTACGGCTGTACTCACTTTATTAGAC +CTAAGTATAAAAGTGAGGGCTTAATGAATAAGATCACAAATAAAGTTAAACCACCTGCTC +AAAAAGCAGTCGGTAAATCTGCAAGTAAAATAACAGTTGGAAGTAAAGCGCCTTATAACC +TTAAATGGTCAAAAGGTGCTTATTTTAATGCGAAAATCGACGGCTTAGGTGCTACTTCAG +CCACTAGATACGGTGATAATCGTACTAACTATAGATTCGATGTTGGACAGGCTGTATACG +CGCCTGGAACATTAATATATGTGTTTGAAATTATAGATGGTTGGTGTCGCATTTATTGGA +ACAATCATAATGAGTGGATATGGCATGAGAGATTGATTGTGAAAGAAGTGTTTTAATTCT +TAGGTTAAAATGTTAAATATTTGTTAATTATTTTTTAATGTAAGTTTAGTTTCTTTTAAT +ATTTTATTGATTTTTAATATTTTTTCGATATAAAATGAAGTTGTTGATATTTATCATCTT +AAATAAGGGTGTTAGCTATAAAAAGAGATAAATAAAAACAAATATATTATATTTGGAGGA +AGCGCCATGCTCAAAAGAAGTTTATTATTTTTAACTGTTTTATTGTTATTATTCTCATTT +TCTTCAATTACTAATGAGGTAAGTGCATCAAGTTCATTCGACAAAGGAAAATATAAAAAA +GGCGATGACGCGAGTTATTTTGAACCAACAGGCCCGTATTTGATGGTAAATGTGACTGGA +GTTGATGGTAAAGGAAATGAATTGCTATCCCCTCATTATGTCGAGTTTCCTATTAAACCT +GGGACTACACTTACAAAAGAAAAAATTGAATACTATGTCGAATGGGCATTAGATGCGACA +GCATATAAAGAGTTTAGAGTAGTTGAATTAGATCCAAGCGCAAAGATCGAAGTCACTTAT +TATGATAAGAATAAGAAAAAAGAAGAAACGAAGTCTTTCCCTATAACAGAAAAAGGTTTT +GTTGTCCCAGATTTATCAGAGCATATTAAAAACCCTGGATTCAACTTAATTACAAAGGTT +ATTATAGAAAAGAAATAAAACAAAATAGTTGTTTATTATAGAAAGCAATGTCTTGATTGA +ATATGTGTAGTGAAAATTATCTTTCATCAAATTCTCATTCATGCACGAATGGTTCTTCCC +CACCTAATCAGATATTAGGTGACTTATGGGGAGAAATCAGTTAGGATGAAAAAGTGGATA +ATCCTTTTTTAGGCAGGTACTTCGGTACTTGCCTATTTTTTTATGTTATAATCTTTCTAG +ACGTATTCAAGGGACGTCTTTTTAGATTGTATGTTATAGCTAGCTTTCGGGCTAGTTTTT +TGTTATGATGTGTTACACATGCATCAACTATTTACATCTATCCTTGTTCACCCAAGCATG +TCACTGGGTGTTTTTTCTTATGATAGAGAGCATAGTTTTCATACTACTCCCTCGTAGTAT +ATATGACTTTAGCATTCCCGTATAATAGTTTACGGGGTGCTTTTTATGTTATAATTAACT +GTATATAGTAGGAGTGAACTATATAGCCTGTTAAGTGGCCTAGTAACCTAACACTTATCC +TGCAATTGATATCCTTTTTGCCCTTCACTCGATACATATATCTCAACAACATAGAAATAT +TACAGTCGCTACACCGCATCTTAAATGGTGTGGTTATTTTTATTGGAAGTGTGTATCAGG +TATCAGTAATGTTAAAACACCAGCTAAAAATGAAAAGAATTCACCAGTGCCAGCAGGTTA +TACACTCGATAAAAACAATGTACCGTATAAAAAAGAGACTGGTTATTACACAGTTGCCAA +TGTTAAAGGTAATAACGTGAGGGATGGCTATTCAACTAATTCAAGAATTACAGGTGTATT +ACCCAATAACGCAACTATCAAATATGACGGCGCATATTGCATTAATGGCTATAGATGGAT +TACTTATATTGCTAATAGTGGACAACGTCGTTATATAGCGACAGGAGAGGTAGACAAGGC +AGGTAATAGAATAAGCAGTTTTGGTAAGTTTAGTGCAGTTTGATAATTAGATATATAAAG +GTTTGGCAAGTTATGAAATGTCTGCCAAACCTTTATATAAAAAAGAAATATCTACCTTTT +AATTTATGTAACTACTATTAGTATGCATATTCATTAGTTTTTCCAGGACCATTAATTACA +TAAGATGATTTAGACTCTCCTTTTTTAAAGAAGTATGTTTTATACATTTTACCTAGTAAC +TCAACATTTTTTCTATCTTCAGCAAGTGGTGTATTCAGATATACTGTATAGTAACCTTTA +TTTTCAGTTAAAATAACCATTTTTTCAAATTGAGCAGAATTTTTTGTGCCTTTCTTTAAA +TAATTTCTCAAACGTTCATCTAATTTTCCTAGTGTTGTAGGAAGACCACTATTTTTAAAT +GATTCTTTATAAGCTTTTTCTTTCTCTAACAATTTCTTATTTGATTCTATTTCTTCATTT +GTAGGAAACGGTTCAAAAGTAAAAGCTTTCGCTGAATGATGGTGTGTACTGATTCCTGCC +GTTAAAAAACTTAATGCTAAAACTGTTGTTGCTAATTTCTTTTTCATAATGATGTTAATT +CTCCTTAAATTCTATATTTAAATTTATAGTTAGTTTTGCGAAATTCCTAAAATGAGTTTA +ATCTAATCGATGAAATATATTAATTAACTGGAAATTAATAAAAGATTAATTATTTTTAAC +TCAAAATTAAAGTTCAATTAGTGTTTTGATGAATTTGGTCTTGATAAATTGAAATGATCT +AAAAAACGCTATAATTTTTCTATTAATAGTAATTAATATGTGCTATATTTATCTTAGACA +CAGCAATGTGTTCAAATTTTCATCTATTCATAAGCTAGCCTTCGGGCTAGTTTTTTTGTG +CTATATATTTGTTTTAATTAAATAAAATTAGATAATGCAATAGTAGCCATTTTATGTTAA +TATTACCTTGGGCGTTTTCAAGGAGCGCCTTTCATTTTTTATGTATTGCTCCCCTTCGGG +CTAGTATATTAAATTTATTTTTGCGCTTTCCAAATCAATGTATATGTGTTATATTGTTTA +TGGGAAGTAGGTAAGCATTTCGGTGCTTACCTTTTTTTGTTTTTCTATAAATACAATAAG +GTATGTCAATTTGATAATTTATTAATTTTCATTTAATAAGAAGATCTATATAGTTAATGA +ATAATTAATGTACTTTTTTTTAGTTAGTCATTAAAATAAATTAGTACTAATTACTAAGGA +GAATAAAAAATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCA +TCACCACTAGTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACA +TCGAATGAATATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTA +AATGTTAATGAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATT +TCAGGTCTAAAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCA +AAATATCAACTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA +AAAAACCACCCTTTTACGGGTGGTTTTAATTTTCTAGATAATATAAAAGTGTTCATAAAT +AAAACAGTATAGGCAAACAATAAAGTATTGAAAAAAGTAAGTTTAATATGAAAATTGTTA +AATGAACGACATCTTTTGTTTTTATAAATATCAAGAAAATAATCAAACTCAAAATAAATA +ACGTAACTGTAGTCATAGGCGTCCATACATAATCAGCATTAGTCATTAAGAATGGTGCAG +CCATTATGAAAAAATTTATAATGCAGATGAAATAGACAATTAGACTATAAATTAGGTAAA +TAACAATACACACCCTTCATAAATAAATAATTTAAATCCTATATATTTTAACAAAAGTAA +AACACAGAAGTGTAGAAAATAAAAAATATTGGTAAATAAAATCAATAAGTTTAACCAATA +TGTTGCTCGCTTCATACCGTATATTGCAACAAAAATTCCGATCAAGAAAAATATAGCCCC +TATGATAAAACAGAAATCCGATGCTGAACTATTAAAAAATGAGGTGTTTAGAGTTAGAAA +ATGAGTTAATGAGTTGACTATAACTAATAAGATATTAATTATATTTGTATGGTTCTTCAC +ATGATACCTCCAAGTAAAAAAATCTAATTAATAAAGTGAATGCTTGATGAACAAGCAGTT +ATTCCAAACAGAATCAATAAGAAAAGTAGAATCAACATGCTAATGCCCCATAAACAACCC +TTTTCACTTTCTCTATTATTAATTTCTTGACTTCTTTTTAAAGATTTATTACTTTTACAT +TCTTTAGTTGTTTTAAATTTCACGTTTTTATTACTTCCTTTTGTCTAAAAGTTTACAATG +AATTTTTGATTATAATAATATATTCAAAATAGTACTATCTAGTTTGATATGTCAAGCAAT +ATTATTATAAAATTGGAATTCTGAGTTGTCTACTCTAATTTATTATATTTACCTATAAAA +ATACACCTCAAAAAATAGATTTTTCAGTCTAGCTTTTGGGGTGTACATTCCACACAAACA +TGTGATTATTTTGATGTTTCTATTAAACTTGTAATTTTAAATTTAAAGTCCCTAAAAAGT +CCCTAAAATTTTATTTTATATGGGGTATTATTGATAATGATAAAGTTATAAACCTTGATA +TTATGCTGTTTTACTTTTTGAATGATAAGTAATTTTATGTTAAAAGTCTCCAGTTTGGAT +AC diff --git a/tests/test_data/golden/rfam/pharokka.tbl b/tests/test_data/golden/rfam/pharokka.tbl new file mode 100644 index 0000000..ae72ca0 --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka.tbl @@ -0,0 +1,434 @@ +>Feature NC_004617.1 +1096 59 CDS + product integrase + function integration and excision + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +1087 1188 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +1204 1818 CDS + product Na/K ATPase + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +1940 1815 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +2164 1997 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +2323 2234 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +3148 2378 CDS + product transcriptional repressor + function transcription regulation + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +3130 3225 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +3307 3531 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +3549 3809 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +4372 3833 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +4429 5178 CDS + product anti-repressor Ant + function transcription regulation + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +5194 5391 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +5422 5562 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +6209 5577 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +6268 6588 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +6585 6746 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +6839 7099 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +7109 7330 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +7323 8102 CDS + product Sak4-like ssDNA annealing protein + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +8133 8684 CDS + product single strand DNA binding protein + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +8697 9368 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +9365 9514 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +9788 9507 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +9764 10624 CDS + product replication initiation protein + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +10634 11413 CDS + product DnaC-like helicase loader + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +11407 11565 CDS + product transcriptional regulator + function transcription regulation + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +11578 11799 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +11810 12214 CDS + product Holliday junction resolvase + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +12219 12404 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +12405 12776 CDS + product Panton-Valentine leukocicin + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +12777 13025 CDS + product virulence associated + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +13089 13436 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +13433 13822 CDS + product acetyltransferase + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +13815 14069 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +14056 14226 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +14219 14755 CDS + product nucleoside triphosphate pyrophosphohydrolase + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +14792 14965 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +14982 15188 CDS + product transcriptional regulator + function transcription regulation + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +15185 15334 CDS + product RinB-like transcriptional activator + function transcription regulation + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +15334 15534 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +15557 16027 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +16142 16594 CDS + product MazG-like pyrophosphatase + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +16610 16954 CDS + product HNH endonuclease + function DNA, RNA and nucleotide metabolism + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +16985 17080 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +17084 17551 CDS + product terminase small subunit + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +17554 19248 CDS + product terminase large subunit + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +19393 20718 CDS + product portal protein + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +20711 21295 CDS + product head maturation protease + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +21383 22630 CDS + product major head protein + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +22666 22824 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +22833 23165 CDS + product head-tail adaptor Ad1 + function connector + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +23152 23487 CDS + product head closure Hc1 + function connector + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +23487 23864 CDS + product tail completion or Neck1 protein + function connector + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +23861 24241 CDS + product tail terminator + function connector + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +24242 25195 CDS + product major tail protein + function tail + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +25260 25706 CDS + product head-tail adaptor + function connector + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +25781 25888 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +25944 30596 CDS + product tail length tape measure protein + function tail + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +30596 32086 CDS + product distal tail protein Dit + function tail + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +32102 35887 CDS + product minor head protein + function head and packaging + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +35877 36029 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +36076 36363 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +36487 36717 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +37033 36824 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +37203 37096 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +37255 37509 CDS + product holin + function lysis + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +37521 38276 CDS + product endolysin + function lysis + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +38467 38958 CDS + product kinase + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39003 39104 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39114 39248 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39248 39385 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39486 39740 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39744 39878 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +39940 40041 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +40487 40038 CDS + product chemotaxis inhibition protein + function moron, auxiliary metabolic gene and host takeover + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +40854 40994 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +40966 41076 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +41170 41520 CDS + product complement inhibitor + function other + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +41764 41573 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +42120 41812 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +42160 42270 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +42722 42603 CDS + product hypothetical protein + function unknown function + inference ab initio prediction:PHANOTATE:1.6.7 + transl_table 11 +36836 37015 ncRNA + inference profile:Infernal:1.1.5 + ncRNA_class ncRNA + product Listeria sRNA rli28 + db_xref RFAM:RF01492 + note rli28 +39255 39405 ncRNA + inference profile:Infernal:1.1.5 + ncRNA_class ncRNA + product Small pathogenicity island RNA X + db_xref RFAM:RF02672 + note SprX +40870 41011 ncRNA + inference profile:Infernal:1.1.5 + ncRNA_class ncRNA + product Small pathogenicity island RNA D + db_xref RFAM:RF01828 + note SprD diff --git a/tests/test_data/golden/rfam/pharokka_aragorn.gff b/tests/test_data/golden/rfam/pharokka_aragorn.gff new file mode 100644 index 0000000..1640630 --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_aragorn.gff @@ -0,0 +1 @@ + diff --git a/tests/test_data/golden/rfam/pharokka_cds_final_merged_output.tsv b/tests/test_data/golden/rfam/pharokka_cds_final_merged_output.tsv new file mode 100644 index 0000000..cd2ca1b --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_cds_final_merged_output.tsv @@ -0,0 +1,84 @@ +gene start stop strand contig score mmseqs_phrog mmseqs_alnScore mmseqs_seqIdentity mmseqs_eVal pyhmmer_phrog pyhmmer_bitscore pyhmmer_evalue custom_hmm_id custom_hmm_bitscore custom_hmm_evalue phrog Method Region color annot category vfdb_hit vfdb_alnScore vfdb_seqIdentity vfdb_eVal vfdb_short_name vfdb_description vfdb_species CARD_hit CARD_alnScore CARD_seqIdentity CARD_eVal CARD_species ARO_Accession CARD_short_name Protein_Accession DNA_Accession AMR_Gene_Family Drug_Class Resistance_Mechanism transl_table +PHARTEST_CDS_0001 1096 59 - NC_004617.1 -1224391000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1 267.068573 1.0707870946004186e-78 No_custom_HMM No_custom_HMM No_custom_HMM 1 ab initio prediction:PHANOTATE:1.6.7 CDS #fea328 integrase integration and excision None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0002 1087 1188 + NC_004617.1 -0.7254348 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0003 1204 1818 + NC_004617.1 -336329.9 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 716 449.149689 3.8695210588739586e-135 No_custom_HMM No_custom_HMM No_custom_HMM 716 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 Na/K ATPase other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0004 1940 1815 - NC_004617.1 -6.788884 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 787 97.506477 7.256432256159493e-28 No_custom_HMM No_custom_HMM No_custom_HMM 787 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0005 2164 1997 - NC_004617.1 -3.693734 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1176 125.481537 1.1061609695818336e-36 No_custom_HMM No_custom_HMM No_custom_HMM 1176 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0006 2323 2234 - NC_004617.1 -5.398136 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 17436 77.476707 9.77277945598196e-22 No_custom_HMM No_custom_HMM No_custom_HMM 17436 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0007 3148 2378 - NC_004617.1 -5833512000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4 137.831955 9.182304306363942e-40 No_custom_HMM No_custom_HMM No_custom_HMM 4 ab initio prediction:PHANOTATE:1.6.7 CDS #a861e3 transcriptional repressor transcription regulation None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0008 3130 3225 + NC_004617.1 -0.261276 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0009 3307 3531 + NC_004617.1 -411.6681 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0010 3549 3809 + NC_004617.1 -3711.756 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 6175 199.621872 1.042600345247173e-59 No_custom_HMM No_custom_HMM No_custom_HMM 6175 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0011 4372 3833 - NC_004617.1 -117442.9 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 10240 413.66687 1.3143145597370256e-124 No_custom_HMM No_custom_HMM No_custom_HMM 10240 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0012 4429 5178 + NC_004617.1 -64592260.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 63 277.715881 4.346377250350118e-82 No_custom_HMM No_custom_HMM No_custom_HMM 63 ab initio prediction:PHANOTATE:1.6.7 CDS #a861e3 anti-repressor Ant transcription regulation None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0013 5194 5391 + NC_004617.1 -562.1181 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 845 117.767677 4.8629365996584375e-34 No_custom_HMM No_custom_HMM No_custom_HMM 845 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0014 5422 5562 + NC_004617.1 -226.453 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1263 108.890617 1.7513858970211352e-31 No_custom_HMM No_custom_HMM No_custom_HMM 1263 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0015 6209 5577 - NC_004617.1 -369622.9 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4768 482.701416 1.823635107023208e-145 No_custom_HMM No_custom_HMM No_custom_HMM 4768 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0016 6268 6588 + NC_004617.1 -819.0921 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 823 137.437347 3.48593695411987e-40 No_custom_HMM No_custom_HMM No_custom_HMM 823 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0017 6585 6746 + NC_004617.1 -14.63112 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 369 97.260277 1.1065048942745614e-27 No_custom_HMM No_custom_HMM No_custom_HMM 369 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0018 6839 7099 + NC_004617.1 -247.9693 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 401 141.015884 2.2143514716706615e-41 No_custom_HMM No_custom_HMM No_custom_HMM 401 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0019 7109 7330 + NC_004617.1 -413.1051 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 946 123.100174 8.837650809222448e-36 No_custom_HMM No_custom_HMM No_custom_HMM 946 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0020 7323 8102 + NC_004617.1 -990899.9 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 124 203.988266 9.283253797681418e-60 No_custom_HMM No_custom_HMM No_custom_HMM 124 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 Sak4-like ssDNA annealing protein DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0021 8133 8684 + NC_004617.1 -1198907.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 378 126.894318 1.7730939919768756e-36 No_custom_HMM No_custom_HMM No_custom_HMM 378 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 single strand DNA binding protein DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0022 8697 9368 + NC_004617.1 -302118.5 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 398 336.357849 1.5735014925911786e-100 No_custom_HMM No_custom_HMM No_custom_HMM 398 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0023 9365 9514 + NC_004617.1 -207.6077 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1902 116.873741 6.095310871626042e-34 No_custom_HMM No_custom_HMM No_custom_HMM 1902 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0024 9788 9507 - NC_004617.1 -376.2408 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1090 134.534958 2.2706350277692987e-39 No_custom_HMM No_custom_HMM No_custom_HMM 1090 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0025 9764 10624 + NC_004617.1 -26027360.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 428 349.326904 7.851672054330485e-104 No_custom_HMM No_custom_HMM No_custom_HMM 428 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 replication initiation protein DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0026 10634 11413 + NC_004617.1 -876131.3 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 50 318.042694 3.1368762368642624e-94 No_custom_HMM No_custom_HMM No_custom_HMM 50 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 DnaC-like helicase loader DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0027 11407 11565 + NC_004617.1 -17.82607 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 809 119.279076 9.850927107372197e-35 No_custom_HMM No_custom_HMM No_custom_HMM 809 ab initio prediction:PHANOTATE:1.6.7 CDS #a861e3 transcriptional regulator transcription regulation None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0028 11578 11799 + NC_004617.1 -142.4595 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 433 129.571747 8.219454885608518e-38 No_custom_HMM No_custom_HMM No_custom_HMM 433 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0029 11810 12214 + NC_004617.1 -576.0835 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 190 212.01207 2.729579477779303e-62 No_custom_HMM No_custom_HMM No_custom_HMM 190 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 Holliday junction resolvase DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0030 12219 12404 + NC_004617.1 -67.00934 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 299 128.243027 1.7537204723584887e-37 No_custom_HMM No_custom_HMM No_custom_HMM 299 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0031 12405 12776 + NC_004617.1 -4011.613 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 201 132.639252 3.336275956158407e-38 No_custom_HMM No_custom_HMM No_custom_HMM 201 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 Panton-Valentine leukocicin DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0032 12777 13025 + NC_004617.1 -46.32995 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 258 171.407745 6.743460509447135e-51 No_custom_HMM No_custom_HMM No_custom_HMM 258 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 virulence associated other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0033 13089 13436 + NC_004617.1 -70910.01 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 24347 240.27034 3.5473389084695518e-71 No_custom_HMM No_custom_HMM No_custom_HMM 24347 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0034 13433 13822 + NC_004617.1 -22939.32 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 742 206.276245 3.1903373555059686e-61 No_custom_HMM No_custom_HMM No_custom_HMM 742 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 acetyltransferase other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0035 13815 14069 + NC_004617.1 -1762.447 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4380 166.499969 1.3389836693335124e-48 No_custom_HMM No_custom_HMM No_custom_HMM 4380 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0036 14056 14226 + NC_004617.1 -600.1063 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1235 106.763283 1.1218764270825162e-30 No_custom_HMM No_custom_HMM No_custom_HMM 1235 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0037 14219 14755 + NC_004617.1 -33454.96 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 173 200.410187 5.251223899986754e-59 No_custom_HMM No_custom_HMM No_custom_HMM 173 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 nucleoside triphosphate pyrophosphohydrolase DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0038 14792 14965 + NC_004617.1 -75.45788 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 3521 144.207062 1.5671823914100208e-42 No_custom_HMM No_custom_HMM No_custom_HMM 3521 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0039 14982 15188 + NC_004617.1 -54.02398 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 278 124.530312 2.3524903545332235e-36 No_custom_HMM No_custom_HMM No_custom_HMM 278 ab initio prediction:PHANOTATE:1.6.7 CDS #a861e3 transcriptional regulator transcription regulation None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0040 15185 15334 + NC_004617.1 -33.26004 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 152 82.207588 4.3279785944476866e-23 No_custom_HMM No_custom_HMM No_custom_HMM 152 ab initio prediction:PHANOTATE:1.6.7 CDS #a861e3 RinB-like transcriptional activator transcription regulation None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0041 15334 15534 + NC_004617.1 -338.2886 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 386 103.850288 8.457111433901045e-30 No_custom_HMM No_custom_HMM No_custom_HMM 386 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0042 15557 16027 + NC_004617.1 -443.2011 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1058 200.117889 2.523946736178659e-59 No_custom_HMM No_custom_HMM No_custom_HMM 1058 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0043 16142 16594 + NC_004617.1 -32234.19 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 229 91.883896 1.032563626542706e-25 No_custom_HMM No_custom_HMM No_custom_HMM 229 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 MazG-like pyrophosphatase other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0044 16610 16954 + NC_004617.1 -5902.167 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 144 140.237381 1.0277314201144125e-40 No_custom_HMM No_custom_HMM No_custom_HMM 144 ab initio prediction:PHANOTATE:1.6.7 CDS #ffdf59 HNH endonuclease DNA, RNA and nucleotide metabolism None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0045 16985 17080 + NC_004617.1 -1.419676 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0046 17084 17551 + NC_004617.1 -401471.4 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 83 158.882233 3.034899146039495e-46 No_custom_HMM No_custom_HMM No_custom_HMM 83 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 terminase small subunit head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0047 17554 19248 + NC_004617.1 -1.423703e+16 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 9 520.940918 1.7759400174402705e-155 No_custom_HMM No_custom_HMM No_custom_HMM 9 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 terminase large subunit head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0048 19393 20718 + NC_004617.1 -3526820000000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 12 344.339081 3.892146619209856e-102 No_custom_HMM No_custom_HMM No_custom_HMM 12 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 portal protein head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0049 20711 21295 + NC_004617.1 -718699.2 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 9644 358.857056 6.051471861451815e-107 No_custom_HMM No_custom_HMM No_custom_HMM 9644 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 head maturation protease head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0050 21383 22630 + NC_004617.1 -1037907000000000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 10 246.293701 1.9934186758679204e-72 No_custom_HMM No_custom_HMM No_custom_HMM 10 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 major head protein head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0051 22666 22824 + NC_004617.1 -35.50524 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 933 74.77906 8.039590127841853e-21 No_custom_HMM No_custom_HMM No_custom_HMM 933 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0052 22833 23165 + NC_004617.1 -1015.769 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 40 103.266396 2.2938727207420487e-29 No_custom_HMM No_custom_HMM No_custom_HMM 40 ab initio prediction:PHANOTATE:1.6.7 CDS #35d7ff head-tail adaptor Ad1 connector None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0053 23152 23487 + NC_004617.1 -125.4829 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 25 86.334061 6.802026473195216e-24 No_custom_HMM No_custom_HMM No_custom_HMM 25 ab initio prediction:PHANOTATE:1.6.7 CDS #35d7ff head closure Hc1 connector None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0054 23487 23864 + NC_004617.1 -45675.83 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 5 50.863125 3.674915746203383e-13 No_custom_HMM No_custom_HMM No_custom_HMM 5 ab initio prediction:PHANOTATE:1.6.7 CDS #35d7ff tail completion or Neck1 protein connector None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0055 23861 24241 + NC_004617.1 -621.686 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 78 99.293671 3.968445180011377e-28 No_custom_HMM No_custom_HMM No_custom_HMM 78 ab initio prediction:PHANOTATE:1.6.7 CDS #35d7ff tail terminator connector None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0056 24242 25195 + NC_004617.1 -68775320000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 88 257.324738 3.587985147385054e-76 No_custom_HMM No_custom_HMM No_custom_HMM 88 ab initio prediction:PHANOTATE:1.6.7 CDS #07e9a2 major tail protein tail None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0057 25260 25706 + NC_004617.1 -45214.34 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 187 76.109634 4.5227752021149915e-21 No_custom_HMM No_custom_HMM No_custom_HMM 187 ab initio prediction:PHANOTATE:1.6.7 CDS #35d7ff head-tail adaptor connector None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0058 25781 25888 + NC_004617.1 -2.584621 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 15504 96.606468 1.3038696410672858e-27 No_custom_HMM No_custom_HMM No_custom_HMM 15504 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0059 25944 30596 + NC_004617.1 -1.857625e+36 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4070 1541.820679 0.0 No_custom_HMM No_custom_HMM No_custom_HMM 4070 ab initio prediction:PHANOTATE:1.6.7 CDS #07e9a2 tail length tape measure protein tail None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0060 30596 32086 + NC_004617.1 -27602240000000.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 202 448.98291 5.166191786100614e-134 No_custom_HMM No_custom_HMM No_custom_HMM 202 ab initio prediction:PHANOTATE:1.6.7 CDS #07e9a2 distal tail protein Dit tail None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0061 32102 35887 + NC_004617.1 -1.286733e+36 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1786 2191.111572 0.0 No_custom_HMM No_custom_HMM No_custom_HMM 1786 ab initio prediction:PHANOTATE:1.6.7 CDS #3e83f6 minor head protein head and packaging None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0062 35877 36029 + NC_004617.1 -401.7119 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1399 94.739922 3.760126853475092e-27 No_custom_HMM No_custom_HMM No_custom_HMM 1399 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0063 36076 36363 + NC_004617.1 -35927.44 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 1747 144.946472 1.4115595753420395e-42 No_custom_HMM No_custom_HMM No_custom_HMM 1747 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0064 36487 36717 + NC_004617.1 -87.5808 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 276 120.104294 6.826397094524996e-35 No_custom_HMM No_custom_HMM No_custom_HMM 276 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0065 37033 36824 - NC_004617.1 -0.06822175 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0066 37203 37096 - NC_004617.1 -0.5872936 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0067 37255 37509 + NC_004617.1 -1784.258 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 297 96.889633 2.477333767281086e-27 No_custom_HMM No_custom_HMM No_custom_HMM 297 ab initio prediction:PHANOTATE:1.6.7 CDS #f35f49 holin lysis None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0068 37521 38276 + NC_004617.1 -2998422.0 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 635 302.353027 1.233910419934025e-89 No_custom_HMM No_custom_HMM No_custom_HMM 635 ab initio prediction:PHANOTATE:1.6.7 CDS #f35f49 endolysin lysis None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0069 38467 38958 + NC_004617.1 -325788.2 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4358 345.576019 6.187265519050315e-104 No_custom_HMM No_custom_HMM No_custom_HMM 4358 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 kinase other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0070 39003 39104 + NC_004617.1 -1.780166 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0071 39114 39248 + NC_004617.1 -0.6784799 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0072 39248 39385 + NC_004617.1 -1.277119 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0073 39486 39740 + NC_004617.1 -0.4697653 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0074 39744 39878 + NC_004617.1 -12.59126 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0075 39940 40041 + NC_004617.1 -0.216365 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0076 40487 40038 - NC_004617.1 -86531.41 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 7039 338.057129 8.887795786500081e-102 No_custom_HMM No_custom_HMM No_custom_HMM 7039 ab initio prediction:PHANOTATE:1.6.7 CDS #ff59f5 chemotaxis inhibition protein moron, auxiliary metabolic gene and host takeover None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0077 40854 40994 + NC_004617.1 -1.753655 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0078 40966 41076 + NC_004617.1 -0.7492102 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0079 41170 41520 + NC_004617.1 -21051.94 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 4954 254.800079 2.040736682625516e-76 No_custom_HMM No_custom_HMM No_custom_HMM 4954 ab initio prediction:PHANOTATE:1.6.7 CDS #838383 complement inhibitor other None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0080 41764 41573 - NC_004617.1 -3.10709 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 20340 146.970062 2.9685237854157818e-43 No_custom_HMM No_custom_HMM No_custom_HMM 20340 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0081 42120 41812 - NC_004617.1 -5.785872 No_MMseqs No_MMseqs No_MMseqs No_MMseqs 19469 169.32724 4.1106975804130616e-50 No_custom_HMM No_custom_HMM No_custom_HMM 19469 ab initio prediction:PHANOTATE:1.6.7 CDS #c9c9c9 hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0082 42160 42270 + NC_004617.1 -7.2915 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 +PHARTEST_CDS_0083 42722 42603 - NC_004617.1 -1.864639 No_MMseqs No_MMseqs No_MMseqs No_MMseqs No_PHROGs_HMM No_PHROGs_HMM No_PHROGs_HMM No_custom_HMM No_custom_HMM No_custom_HMM No_PHROGs_HMM ab initio prediction:PHANOTATE:1.6.7 CDS None hypothetical protein unknown function None None None None None None None None None None None None None None None None None None None 11 diff --git a/tests/test_data/golden/rfam/pharokka_cds_functions.tsv b/tests/test_data/golden/rfam/pharokka_cds_functions.tsv new file mode 100644 index 0000000..3ac60ba --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_cds_functions.tsv @@ -0,0 +1,18 @@ +Description Count contig +CDS 83 NC_004617.1 +connector 5 NC_004617.1 +DNA, RNA and nucleotide metabolism 8 NC_004617.1 +head and packaging 6 NC_004617.1 +integration and excision 1 NC_004617.1 +lysis 2 NC_004617.1 +moron, auxiliary metabolic gene and host takeover 1 NC_004617.1 +other 6 NC_004617.1 +tail 3 NC_004617.1 +transcription regulation 5 NC_004617.1 +unknown function 46 NC_004617.1 +tRNAs 0 NC_004617.1 +CRISPRs 0 NC_004617.1 +tmRNAs 0 NC_004617.1 +ncRNAs 3 NC_004617.1 +VFDB_Virulence_Factors 0 NC_004617.1 +CARD_AMR_Genes 0 NC_004617.1 diff --git a/tests/test_data/golden/rfam/pharokka_length_gc_cds_density.tsv b/tests/test_data/golden/rfam/pharokka_length_gc_cds_density.tsv new file mode 100644 index 0000000..639ecb1 --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_length_gc_cds_density.tsv @@ -0,0 +1,2 @@ +contig length gc_perc transl_table cds_coding_density +NC_004617.1 42722 0.33 11 92.69 diff --git a/tests/test_data/golden/rfam/pharokka_minced.gff b/tests/test_data/golden/rfam/pharokka_minced.gff new file mode 100644 index 0000000..879555f --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_minced.gff @@ -0,0 +1 @@ +##gff-version 3 diff --git a/tests/test_data/golden/rfam/pharokka_ncrna.tsv b/tests/test_data/golden/rfam/pharokka_ncrna.tsv new file mode 100644 index 0000000..6d3a865 --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_ncrna.tsv @@ -0,0 +1,4 @@ +contig locus_tag start stop strand rfam_acc rfam_id type description clan bitscore evalue gc trunc mdl_from mdl_to +NC_004617.1 PHARTEST_ncRNA_1 36836 37015 + RF01492 rli28 Gene; sRNA; Listeria sRNA rli28 94.6 7.4e-11 0.38 no 1 186 +NC_004617.1 PHARTEST_ncRNA_2 39255 39405 + RF02672 SprX Gene; sRNA; Small pathogenicity island RNA X 195.7 1.2e-44 0.37 no 1 151 +NC_004617.1 PHARTEST_ncRNA_3 40870 41011 + RF01828 SprD Gene; sRNA; Small pathogenicity island RNA D 170.4 2.6e-37 0.37 no 1 142 diff --git a/tests/test_data/golden/rfam/pharokka_top_hits_mash_inphared.tsv b/tests/test_data/golden/rfam/pharokka_top_hits_mash_inphared.tsv new file mode 100644 index 0000000..d911a4a --- /dev/null +++ b/tests/test_data/golden/rfam/pharokka_top_hits_mash_inphared.tsv @@ -0,0 +1,2 @@ +contig Accession mash_distance mash_pval mash_matching_hashes Description Classification Genome_Length_(bp) Jumbophage molGC_(%) Molecule Modification_Date Number_CDS Positive_Strand_(%) Negative_Strand_(%) Coding_Capacity_(%) Low_Coding_Capacity_Warning tRNAs Host Lowest_Taxa Genus Sub-family Family Order Class Phylum Kingdom Realm Baltimore_Group Genbank_Division Isolation_Host_(beware_inconsistent_and_nonsense_values) +NC_004617.1 NC_004617 0.0 0.0 1000/1000 Staphylococcus phage phi 13 Staphylococcus phage phi 13 Peeveelvirus pv13 Peeveelvirus Bronfenbrennervirinae Caudoviricetes Uroviricota Heunggongvirae Duplodnaviria Viruses 42722 False 33.472 DNA 11-JAN-2023 64 89.0625 10.9375 86.8709330087543 0 Staphylococcus Peeveelvirus Peeveelvirus Bronfenbrennervirinae Unclassified Unclassified Caudoviricetes Uroviricota Heunggongvirae Duplodnaviria Group I PHG Staphylococcus aureus subsp. aureus NCTC 8325 diff --git a/tests/test_data/golden/rfam/trnascan_out.gff b/tests/test_data/golden/rfam/trnascan_out.gff new file mode 100644 index 0000000..e69de29 diff --git a/tests/test_rfam.py b/tests/test_rfam.py index 285063d..1e6ff59 100644 --- a/tests/test_rfam.py +++ b/tests/test_rfam.py @@ -222,6 +222,18 @@ def test_write_ncrna_tsv(self, tmp_path): assert lines[0].split("\t")[:3] == ["contig", "locus_tag", "start"] assert len(lines) == 2 + def test_write_ncrna_tsv_leaves_empty_fields_unquoted(self, tmp_path): + """Families with no clan should give an empty field, not a literal ''.""" + df = add_locus_tags( + parse_cmscan_tblout(_write_tblout(tmp_path, [_row(clan="-")])), "ABCDE", 1 + ) + write_ncrna_tsv(df, str(tmp_path), "test") + + lines = (tmp_path / "test_ncrna.tsv").read_text().strip().split("\n") + header, row = lines[0].split("\t"), lines[1].split("\t") + assert len(row) == len(header) + assert row[header.index("clan")] == "" + def test_write_ncrna_tsv_when_empty(self, tmp_path): """A header-only file is still written, so the output set is stable.""" write_ncrna_tsv( From 2aba2878ef975a2228c654b6079b1be0dbcf6bc8 Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Mon, 3 Aug 2026 09:39:34 +0930 Subject: [PATCH 08/10] Always write the ncRNAs row to _cds_functions.tsv Previously the row only appeared when Rfam annotation ran, so downstream parsers had to cope with a schema that changed depending on flags. It is now written unconditionally, one row per contig, with a count of 0 when Rfam was skipped. Golden outputs regenerated. The only substantive change is one added ncRNAs line per contig; the .gbk diffs are the LOCUS date line, which the comparator already ignores. Co-Authored-By: Claude Opus 5 --- src/pharokka/post_processing.py | 13 ++++---- tests/test_data/golden/crispr/pharokka.gbk | 2 +- .../golden/crispr/pharokka_cds_functions.tsv | 1 + tests/test_data/golden/fast/pharokka.gbk | 2 +- .../golden/fast/pharokka_cds_functions.tsv | 1 + tests/test_data/golden/genbank/pharokka.gbk | 2 +- .../golden/genbank/pharokka_cds_functions.tsv | 1 + tests/test_data/golden/meta/pharokka.gbk | 10 +++---- .../golden/meta/pharokka_cds_functions.tsv | 5 ++++ tests/test_data/golden/standard/pharokka.gbk | 2 +- .../standard/pharokka_cds_functions.tsv | 1 + tests/test_data/golden/tmrna/pharokka.gbk | 2 +- .../golden/tmrna/pharokka_cds_functions.tsv | 1 + tests/test_rfam.py | 30 +++++++++++++++++++ 14 files changed, 58 insertions(+), 15 deletions(-) diff --git a/src/pharokka/post_processing.py b/src/pharokka/post_processing.py index 8e280b2..efa8694 100644 --- a/src/pharokka/post_processing.py +++ b/src/pharokka/post_processing.py @@ -1988,7 +1988,9 @@ def _counts_by_contig(src_df): crispr_counts = _counts_by_contig(crispr_df) tmrna_counts = _counts_by_contig(tmrna_df) - ncrna_counts = _counts_by_contig(self.ncrna_df) if self.rfam_flag else {} + # counted unconditionally: the ncRNAs row is always written, so that + # _cds_functions.tsv has a stable schema whether or not Rfam ran + ncrna_counts = _counts_by_contig(self.ncrna_df) # ─── VFDB / CARD counts. v1.9.1 used str.contains(contig) on the hit # row's contig column — preserved here in case the test suite ever @@ -2043,10 +2045,11 @@ def _counts_by_contig_contains(src_df, contig_names): counts.append(tmrna_counts.get(contig, 0)) contigs_out.append(contig) - if self.rfam_flag is True: - descriptions.append("ncRNAs") - counts.append(ncrna_counts.get(contig, 0)) - contigs_out.append(contig) + # always emitted, 0 when Rfam did not run, so downstream parsers + # can rely on the row being present + descriptions.append("ncRNAs") + counts.append(ncrna_counts.get(contig, 0)) + contigs_out.append(contig) descriptions.append("VFDB_Virulence_Factors") counts.append(vfdb_counts.get(contig, 0)) diff --git a/tests/test_data/golden/crispr/pharokka.gbk b/tests/test_data/golden/crispr/pharokka.gbk index d5d742c..8949616 100644 --- a/tests/test_data/golden/crispr/pharokka.gbk +++ b/tests/test_data/golden/crispr/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS SR-VP_4-6_scaffold_141_1259094 86088 bp DNA linear PHG 17-JUN-2026 +LOCUS SR-VP_4-6_scaffold_141_1259094 86088 bp DNA linear PHG 02-AUG-2026 DEFINITION SR-VP_4-6_scaffold_141_1259094 (id=222357670). ACCESSION SR-VP_4-6_scaffold_141_1259094 VERSION SR-VP_4-6_scaffold_141_1259094 diff --git a/tests/test_data/golden/crispr/pharokka_cds_functions.tsv b/tests/test_data/golden/crispr/pharokka_cds_functions.tsv index 5055845..2a44cd7 100644 --- a/tests/test_data/golden/crispr/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/crispr/pharokka_cds_functions.tsv @@ -13,5 +13,6 @@ unknown function 113 SR-VP_4-6_scaffold_141_1259094 tRNAs 0 SR-VP_4-6_scaffold_141_1259094 CRISPRs 2 SR-VP_4-6_scaffold_141_1259094 tmRNAs 0 SR-VP_4-6_scaffold_141_1259094 +ncRNAs 0 SR-VP_4-6_scaffold_141_1259094 VFDB_Virulence_Factors 0 SR-VP_4-6_scaffold_141_1259094 CARD_AMR_Genes 0 SR-VP_4-6_scaffold_141_1259094 diff --git a/tests/test_data/golden/fast/pharokka.gbk b/tests/test_data/golden/fast/pharokka.gbk index a7637ca..669b272 100644 --- a/tests/test_data/golden/fast/pharokka.gbk +++ b/tests/test_data/golden/fast/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS MW460250_1 140135 bp DNA linear PHG 17-JUN-2026 +LOCUS MW460250_1 140135 bp DNA linear PHG 02-AUG-2026 DEFINITION MW460250_1. ACCESSION MW460250_1 VERSION MW460250_1 diff --git a/tests/test_data/golden/fast/pharokka_cds_functions.tsv b/tests/test_data/golden/fast/pharokka_cds_functions.tsv index 055c10e..deca22b 100644 --- a/tests/test_data/golden/fast/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/fast/pharokka_cds_functions.tsv @@ -13,5 +13,6 @@ unknown function 153 MW460250_1 tRNAs 3 MW460250_1 CRISPRs 0 MW460250_1 tmRNAs 0 MW460250_1 +ncRNAs 0 MW460250_1 VFDB_Virulence_Factors 0 MW460250_1 CARD_AMR_Genes 0 MW460250_1 diff --git a/tests/test_data/golden/genbank/pharokka.gbk b/tests/test_data/golden/genbank/pharokka.gbk index 5b2c785..7d70f35 100644 --- a/tests/test_data/golden/genbank/pharokka.gbk +++ b/tests/test_data/golden/genbank/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS MW460250_1 140135 bp DNA linear PHG 17-JUN-2026 +LOCUS MW460250_1 140135 bp DNA linear PHG 02-AUG-2026 DEFINITION MW460250_1. ACCESSION MW460250_1 VERSION MW460250_1 diff --git a/tests/test_data/golden/genbank/pharokka_cds_functions.tsv b/tests/test_data/golden/genbank/pharokka_cds_functions.tsv index 20b78f6..f0dafc0 100644 --- a/tests/test_data/golden/genbank/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/genbank/pharokka_cds_functions.tsv @@ -13,5 +13,6 @@ unknown function 154 MW460250_1 tRNAs 3 MW460250_1 CRISPRs 0 MW460250_1 tmRNAs 0 MW460250_1 +ncRNAs 0 MW460250_1 VFDB_Virulence_Factors 0 MW460250_1 CARD_AMR_Genes 0 MW460250_1 diff --git a/tests/test_data/golden/meta/pharokka.gbk b/tests/test_data/golden/meta/pharokka.gbk index a5c61a7..7c13a41 100644 --- a/tests/test_data/golden/meta/pharokka.gbk +++ b/tests/test_data/golden/meta/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS MW460250_1 140135 bp DNA linear PHG 17-JUN-2026 +LOCUS MW460250_1 140135 bp DNA linear PHG 02-AUG-2026 DEFINITION MW460250_1. ACCESSION MW460250_1 VERSION MW460250_1 @@ -5405,7 +5405,7 @@ ORIGIN 140041 atttgataat ttaactatat actatattga taaataagtc aacagttttc taaaaataat 140101 ttaaattatt ttgaagaata ctttaatatc aaggg // -LOCUS NC_004617.1 42722 bp DNA linear PHG 17-JUN-2026 +LOCUS NC_004617.1 42722 bp DNA linear PHG 02-AUG-2026 DEFINITION NC_004617.1 Staphylococcus prophage phi 13, complete genome. ACCESSION NC_004617 VERSION NC_004617.1 @@ -7031,7 +7031,7 @@ ORIGIN 42661 ttatgctgtt ttactttttg aatgataagt aattttatgt taaaagtctc cagtttggat 42721 ac // -LOCUS NC_007458.1 37253 bp DNA linear PHG 17-JUN-2026 +LOCUS NC_007458.1 37253 bp DNA linear PHG 02-AUG-2026 DEFINITION NC_007458.1 Bacillus phage Gamma, complete genome. ACCESSION NC_007458 VERSION NC_007458.1 @@ -8456,7 +8456,7 @@ ORIGIN 37141 ttacaatcac tttgtaatcc atgtcacaac agaaaaacag cagaagacaa aaagaaatac 37201 gggtaggggc gggtcgaaaa acattcaggg cggtctgtcc gtaccgccgc ccc // -LOCUS NC_051700.1 58758 bp DNA linear PHG 17-JUN-2026 +LOCUS NC_051700.1 58758 bp DNA linear PHG 02-AUG-2026 DEFINITION NC_051700.1 Mycobacterium phage Polka14, complete genome. ACCESSION NC_051700 VERSION NC_051700.1 @@ -10892,7 +10892,7 @@ ORIGIN 58681 gcccgcaagc ctctgacctg cggaaacacc cccccagcaa cccccccggg ggggggtctg 58741 cgcggccccg gaaggcgc // -LOCUS SR-VP_4-6_scaffold_141_1259094 86088 bp DNA linear PHG 17-JUN-2026 +LOCUS SR-VP_4-6_scaffold_141_1259094 86088 bp DNA linear PHG 02-AUG-2026 DEFINITION SR-VP_4-6_scaffold_141_1259094 (id=222357670). ACCESSION SR-VP_4-6_scaffold_141_1259094 VERSION SR-VP_4-6_scaffold_141_1259094 diff --git a/tests/test_data/golden/meta/pharokka_cds_functions.tsv b/tests/test_data/golden/meta/pharokka_cds_functions.tsv index 51cb3ef..234b1e9 100644 --- a/tests/test_data/golden/meta/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/meta/pharokka_cds_functions.tsv @@ -13,6 +13,7 @@ unknown function 57 NC_051700.1 tRNAs 1 NC_051700.1 CRISPRs 0 NC_051700.1 tmRNAs 1 NC_051700.1 +ncRNAs 0 NC_051700.1 VFDB_Virulence_Factors 0 NC_051700.1 CARD_AMR_Genes 0 NC_051700.1 CDS 63 NC_004617.1 @@ -29,6 +30,7 @@ unknown function 30 NC_004617.1 tRNAs 0 NC_004617.1 CRISPRs 0 NC_004617.1 tmRNAs 0 NC_004617.1 +ncRNAs 0 NC_004617.1 VFDB_Virulence_Factors 3 NC_004617.1 CARD_AMR_Genes 0 NC_004617.1 CDS 212 MW460250_1 @@ -45,6 +47,7 @@ unknown function 120 MW460250_1 tRNAs 3 MW460250_1 CRISPRs 0 MW460250_1 tmRNAs 0 MW460250_1 +ncRNAs 0 MW460250_1 VFDB_Virulence_Factors 0 MW460250_1 CARD_AMR_Genes 0 MW460250_1 CDS 126 SR-VP_4-6_scaffold_141_1259094 @@ -61,6 +64,7 @@ unknown function 96 SR-VP_4-6_scaffold_141_1259094 tRNAs 0 SR-VP_4-6_scaffold_141_1259094 CRISPRs 2 SR-VP_4-6_scaffold_141_1259094 tmRNAs 0 SR-VP_4-6_scaffold_141_1259094 +ncRNAs 0 SR-VP_4-6_scaffold_141_1259094 VFDB_Virulence_Factors 0 SR-VP_4-6_scaffold_141_1259094 CARD_AMR_Genes 0 SR-VP_4-6_scaffold_141_1259094 CDS 55 NC_007458.1 @@ -77,5 +81,6 @@ unknown function 28 NC_007458.1 tRNAs 0 NC_007458.1 CRISPRs 0 NC_007458.1 tmRNAs 0 NC_007458.1 +ncRNAs 0 NC_007458.1 VFDB_Virulence_Factors 0 NC_007458.1 CARD_AMR_Genes 1 NC_007458.1 diff --git a/tests/test_data/golden/standard/pharokka.gbk b/tests/test_data/golden/standard/pharokka.gbk index 4a7884a..10af6a0 100644 --- a/tests/test_data/golden/standard/pharokka.gbk +++ b/tests/test_data/golden/standard/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS MW460250_1 140135 bp DNA linear PHG 17-JUN-2026 +LOCUS MW460250_1 140135 bp DNA linear PHG 02-AUG-2026 DEFINITION MW460250_1. ACCESSION MW460250_1 VERSION MW460250_1 diff --git a/tests/test_data/golden/standard/pharokka_cds_functions.tsv b/tests/test_data/golden/standard/pharokka_cds_functions.tsv index 1aaad29..a5f622b 100644 --- a/tests/test_data/golden/standard/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/standard/pharokka_cds_functions.tsv @@ -13,5 +13,6 @@ unknown function 154 MW460250_1 tRNAs 3 MW460250_1 CRISPRs 0 MW460250_1 tmRNAs 0 MW460250_1 +ncRNAs 0 MW460250_1 VFDB_Virulence_Factors 0 MW460250_1 CARD_AMR_Genes 0 MW460250_1 diff --git a/tests/test_data/golden/tmrna/pharokka.gbk b/tests/test_data/golden/tmrna/pharokka.gbk index 23194b2..14a7737 100644 --- a/tests/test_data/golden/tmrna/pharokka.gbk +++ b/tests/test_data/golden/tmrna/pharokka.gbk @@ -1,4 +1,4 @@ -LOCUS NC_051700.1 58758 bp DNA linear PHG 17-JUN-2026 +LOCUS NC_051700.1 58758 bp DNA linear PHG 02-AUG-2026 DEFINITION NC_051700.1 Mycobacterium phage Polka14, complete genome. ACCESSION NC_051700 VERSION NC_051700.1 diff --git a/tests/test_data/golden/tmrna/pharokka_cds_functions.tsv b/tests/test_data/golden/tmrna/pharokka_cds_functions.tsv index 0b9269d..7eccc79 100644 --- a/tests/test_data/golden/tmrna/pharokka_cds_functions.tsv +++ b/tests/test_data/golden/tmrna/pharokka_cds_functions.tsv @@ -13,5 +13,6 @@ unknown function 64 NC_051700.1 tRNAs 1 NC_051700.1 CRISPRs 0 NC_051700.1 tmRNAs 1 NC_051700.1 +ncRNAs 0 NC_051700.1 VFDB_Virulence_Factors 0 NC_051700.1 CARD_AMR_Genes 0 NC_051700.1 diff --git a/tests/test_rfam.py b/tests/test_rfam.py index 1e6ff59..30bd96f 100644 --- a/tests/test_rfam.py +++ b/tests/test_rfam.py @@ -248,6 +248,36 @@ def test_write_ncrna_tsv_when_empty(self, tmp_path): ) +class TestCdsFunctionsNcrnaRow: + """The ncRNAs row is always written, even when Rfam did not run.""" + + def test_golden_cases_without_rfam_still_have_an_ncrna_row(self): + golden = os.path.join(TEST_DATA, "golden") + checked = 0 + for case in os.listdir(golden): + path = os.path.join(golden, case, "pharokka_cds_functions.tsv") + if not os.path.isfile(path): + continue + rows = [ + line.split("\t") + for line in open(path).read().strip().split("\n")[1:] + if line + ] + ncrna_rows = [r for r in rows if r[0] == "ncRNAs"] + contigs = {r[-1] for r in rows} + assert ncrna_rows, f"{case}: no ncRNAs row in _cds_functions.tsv" + # one row per contig + assert {r[-1] for r in ncrna_rows} == contigs, ( + f"{case}: ncRNAs row missing for some contigs" + ) + if case != "rfam": + assert all(r[1] == "0" for r in ncrna_rows), ( + f"{case}: expected 0 ncRNAs when Rfam is skipped" + ) + checked += 1 + assert checked > 0, "no golden _cds_functions.tsv files found" + + class TestRfamDatabaseCheck: """check_rfam_installation gates the default-on ncRNA path.""" From c8fc83eea2aa26142f063620116989f2e069f24e Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Mon, 10 Aug 2026 08:54:38 +0930 Subject: [PATCH 09/10] Add web server link to README --- README.md | 2 ++ 1 file changed, 2 insertions(+) diff --git a/README.md b/README.md index cd640d8..d031c1d 100644 --- a/README.md +++ b/README.md @@ -22,6 +22,8 @@ pharokka ================= +### 🌐 Try `pharokka`, `phold` and `phynteny` in your browser - no installation required: **[https://phage-annotation.org](https://phage-annotation.org)** +

pharokka Logo

From 93b54542ebd198d8a6c6e1e93b23964f4418c394 Mon Sep 17 00:00:00 2001 From: gbouras13 Date: Mon, 10 Aug 2026 09:18:08 +0930 Subject: [PATCH 10/10] Fold 1.10.2 into 1.11.0 and document Rfam/Infernal ncRNA integration --- HISTORY.md | 30 +++++++++++++++++++++++++++++- 1 file changed, 29 insertions(+), 1 deletion(-) diff --git a/HISTORY.md b/HISTORY.md index 9c71ebc..f6115a1 100644 --- a/HISTORY.md +++ b/HISTORY.md @@ -1,14 +1,42 @@ History ======= -1.10.2 (2026-07-20) +1.11.0 (2026-08-10) ------------- +**Requires a database update - re-run `pharokka install` before using this version** + +* Adds ncRNA annotation with [Infernal](http://eddylab.org/infernal/) `cmscan` against + [Rfam](https://rfam.org) 15.1 (4,227 covariance models). This picks up structured RNAs + that `pharokka` previously missed entirely - riboswitches, ribozymes, regulatory sRNAs, + group I/II introns and leader elements + * Runs by default in single-genome mode, since it is cheap for a phage genome + (~5 seconds for a 40 kb phage, ~14 seconds for a 140 kb phage on 8 threads, and + scales well with `--threads`). Pass `--skip_rfam` to disable it + * Skipped by default in meta mode (`-m`) since runtime scales with assembly size + (~2 min/Mbp on 8 threads). Pass `--meta_rfam` to run it anyway in meta mode + * By default, Rfam tRNA (RF00005) and tmRNA (RF00023) hits are discarded, since + tRNAscan-SE and ARAGORN already annotate these and are more sensitive for phage + sequence. Pass `--rfam_keep_trna` to keep them + * Rfam is purely additive - it does **not** replace tRNAscan-SE, ARAGORN or MinCED + * Adds new outputs: `{prefix}_ncrna.tsv` (one row per ncRNA hit, with Rfam accession, + family, type, coordinates, bit score and E-value), `{prefix}_cmscan.tblout` (raw + Infernal output), and `ncRNA` features in the `.gff`/`.gbk` (plus an `ncRNAs` row + per contig in `{prefix}_cds_functions.tsv`) + * Requires [Infernal](http://eddylab.org/infernal/) `>= 1.1.4` (`conda install -c + bioconda infernal`), only checked when Rfam annotation will actually run + * Requires the v1.11.0 database (adds the pressed Rfam covariance models) - running + against an older database will fail with an explanatory error unless `--skip_rfam` + is passed * `pharokka run --citation` (and the end-of-run summary) now also print our [protocols paper](https://doi.org/10.1002/cpz1.70405) citation alongside the existing Pharokka citation * Fixes a duplicated author name (`Vreugde S.`) in the protocols paper citation in the README and docs +* Fixes the database tarball filename being hardcoded to `v1.8.0` rather than derived + from the database version +* The PHROGs database version marker file is now derived from the database version + instead of being hardcoded 1.10.1 (2026-07-09) -------------